SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007053280.1.37587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007053280.1.37587
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000233
Family Cystathionine synthase-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007053280.1.37587
Sequence length 89
Comment cystathionine beta-lyase [Bifidobacterium longum]; AA=GCF_000261205.1; RF=na; TAX=1161745; STAX=216816; NAME=Bifidobacterium longum subsp. longum 2-2B; strain=2-2B; AL=Contig; RT=Major
Sequence
MGVDFRTQAIHAGYEPLDNGRAAVPPIYASAAFDLGDAARGDALAGGDIDGFEYSRVANP
TVDALEKRLAALEDGIGAVAVGSGMAAAY
Download sequence
Identical sequences A0A0A1GPQ5 A0A0M0VPG9 C5EDZ5 E8MUV3 F8AUC3 I3B4Q6 Q8G801 R5MUJ5
gi|384201138|ref|YP_005586885.1| NP_695312.1.18194 WP_007053280.1.10685 WP_007053280.1.15467 WP_007053280.1.23590 WP_007053280.1.26381 WP_007053280.1.29295 WP_007053280.1.35419 WP_007053280.1.37587 WP_007053280.1.41489 WP_007053280.1.46548 WP_007053280.1.4820 WP_007053280.1.50584 WP_007053280.1.50944 WP_007053280.1.51653 WP_007053280.1.51719 WP_007053280.1.51739 WP_007053280.1.54925 WP_007053280.1.55246 WP_007053280.1.56191 WP_007053280.1.59950 WP_007053280.1.61280 WP_007053280.1.62466 WP_007053280.1.76144 WP_007053280.1.76173 WP_007053280.1.94251 WP_007053280.1.98069 WP_007053280.1.98685 WP_007053280.1.99722 206672.BL0083 gi|23464709|ref|NP_695312.1| gi|322689591|ref|YP_004209325.1| gi|312132404|ref|YP_003999743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]