SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007090956.1.98143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007090956.1.98143
Domain Number 1 Region: 721-964
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.14e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 2 Region: 20-204
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.35e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.037
Further Details:      
 
Domain Number 3 Region: 433-616
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000042
Family Pyruvate oxidase and decarboxylase PP module 0.068
Further Details:      
 
Domain Number 4 Region: 266-395
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000359
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007090956.1.98143
Sequence length 1160
Comment MFS transporter [Thalassospira xiamenensis]; AA=GCF_000300235.2; RF=representative genome; TAX=1123366; STAX=220697; NAME=Thalassospira xiamenensis M-5 = DSM 17429; strain=M-5; AL=Complete Genome; RT=Major
Sequence
MAQLAAISLDDKYTLEEGRVYLTGIQALVRLPLMQRQLDARAGLNTAGCISGYRGSPLGG
LDQQLWRAKKFLTRQQIEFQAGVNEDLAATVVWGSQQVNMYKDAKYDGVFGMWYGKGPGV
DRSGDVFKHANYAGTSKHGGVLVLAGDDHSCKSSTLPHQTEYAFIDAQIPVLNPSGVQDI
LDFGIHGWAMSRYSGCWVAMKTIAETVESSAAVDVAPDRITPIIPDNFDMPEGGLHIRWP
DTPKDQEHRLMKYKLYAALAYARANKLNKTVIDSPNARLGIITTGKAYLDVMQAFDDLGI
SEADAAKIGIRVLKVGMSWPLNRDDVREFAMGLEEIIVVEEKRAVMENQVKEQLYNWRED
VRPTVIGKFDEKGEWILPSMDELTPARIAVVLAQRIKRFYDSPKIHERIDWLEQKEREIA
EPRPDVARIPWFCPGCPHNSSTKVPEGSRAMAGIGCHYMVNWMDRSTETFTHMGGEGVTW
IGQAPFTNTKHVFQNLGDGTYYHSGSLAVRAAVAAGVNITYKILFNDAVAMTGGQPVDGP
LTVPQITRQMADEGVKRIIVLSDEPDKYPVPSHFADGVDIRHRDELDNTQKELREIEGVT
ILIFDQTCAAEKRRRRKRKLMVDPPKRVFINDLVCEGCGDCGEKSNCLAVVPVETEFGRK
RAIDQSACNKDFSCLNGFCPSFVTIEGGALRKPEAAAKSGNAGDAVFASLPRPTLPDITD
PWSVLITGVGGTGVVTIGALLGMAAHIEGKGIVGLDMAGLAQKGGAVVSHIRFADTQEKL
HAARIPAGEANVVLGCDLLVAASFEGLAKMRRNFTQAVINTHETVTGAFTRNPDFQLKSN
EHMKVISDACGADAVNFVEGSDIATRLMGNSIATNLFMLGVAWQRGLIPITEEALMQAID
LNGVAIDMNKQSFYWGRLFAHDPKRVLDVIGPNEAEAHPIATTLSDMVAKRKAFLTDYQN
ATYANRFVALVDRVAAAEKRLDDGDDLARTVAKYYFKLLAYKDEYEVARLYTDPAFRAKL
AKNFTGDYKIRFHLAPPAFADKDPETGHLKKQAFGPWMMSAFGILAKFKFLRGTAIDPFG
RTHERKMERQLIADYEALVDEVINGLNHDNARIANALLALPEQIRGYGHIKDRNIDKVKT
RKAELLEQFRNPPEHLKAAE
Download sequence
Identical sequences A0A0B4XTC0
WP_007090956.1.28964 WP_007090956.1.98143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]