SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007188244.1.84793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007188244.1.84793
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.72e-40
Family GHMP Kinase, N-terminal domain 0.00051
Further Details:      
 
Domain Number 2 Region: 189-304
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.09e-29
Family Mevalonate kinase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007188244.1.84793
Sequence length 327
Comment MULTISPECIES: mevalonate kinase [Haloarcula]; AA=GCF_000337755.1; RF=na; TAX=662475; STAX=244363; NAME=Haloarcula californiae ATCC 33799; strain=ATCC 33799; AL=Contig; RT=Major
Sequence
MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRVHVTATEIDEGLRIHANDLQLDGFTVEY
SGDGESHPDVDVAESLVEAGMGYVNEAVAQARDAADAPEAGFEISVEGDIPLGAGLGSSA
ALVVAAIDAATRELGVELSASDIADRAYQVEHAVQDGQASRADTFCSAMGGAVRVEGDDC
RRLEGIDTLPFVIGYDGGAGDTGALVAGVRDLRGKYDFAADTVAAIGDIVREGESVLGTG
DYERLGELMDFNHGLLSALGVSSRSLDSMVWAARDADAHGAKLTGAGGGGCIVALDETDD
ALTALKYTPGCEDVFRAELDTDGVRQE
Download sequence
Identical sequences M0KLP3 Q5V5P6
272569.rrnAC0077 gi|55377012|ref|YP_134862.1| WP_007188244.1.69175 WP_007188244.1.84793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]