SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007275935.1.100717 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007275935.1.100717
Domain Number 1 Region: 663-900
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.5e-30
Family Quinoprotein alcohol dehydrogenase-like 0.0024
Further Details:      
 
Domain Number 2 Region: 1568-1860
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.43e-27
Family Terpene synthases 0.067
Further Details:      
 
Domain Number 3 Region: 525-700
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.94e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0035
Further Details:      
 
Domain Number 4 Region: 937-1009
Classification Level Classification E-value
Superfamily PKD domain 0.000000000017
Family PKD domain 0.0027
Further Details:      
 
Domain Number 5 Region: 309-415
Classification Level Classification E-value
Superfamily PKD domain 0.000000000968
Family PKD domain 0.0054
Further Details:      
 
Domain Number 6 Region: 439-517
Classification Level Classification E-value
Superfamily PKD domain 0.00000000103
Family PKD domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1028-1095
Classification Level Classification E-value
Superfamily PKD domain 0.0000235
Family PKD domain 0.0062
Further Details:      
 
Weak hits

Sequence:  WP_007275935.1.100717
Domain Number - Region: 1102-1184
Classification Level Classification E-value
Superfamily PKD domain 0.000129
Family PKD domain 0.013
Further Details:      
 
Domain Number - Region: 141-192
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0333
Family Carboxypeptidase regulatory domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007275935.1.100717
Sequence length 1952
Comment hypothetical protein [Haloferax sulfurifontis]; AA=GCF_000337835.1; RF=na; TAX=662480; STAX=255616; NAME=Haloferax sulfurifontis ATCC BAA-897; strain=ATCC BAA-897; AL=Contig; RT=Major
Sequence
MTTRYRHQVGAVSLTIIVLVSLSSPFVAVSGAAAGGSLAGSVDRATGAPAASDVVLAATE
GSEPTNDELSAQGAYNLTGLQSNATYDVSYVAANGSQPGSPGAFPRDGSPDVFALQRASP
GATADLGNAALPDAHVVNLSVVNETGAPVSGAAVAFQHTNANGATVNTSQFGEWFLTESD
GDVHLSNGTAGIELTGNVTVAVAPPRRLSYDGGLEGEPVSSSSGYVQRVYTRQLDVTGDE
TVTVTLEEAEQSGATLTANETAPALGVPVNVSLSNITGETPSFYTWTVDGSYAGYTTHPD
ASLVLTGFSDPGPHTVAVTARSGSEQFLFEESLTLDAATAGDGTLTAAPTPARANLDTVR
FSLANVSGVGDGDFYTWTFGDGDRASTRHPNATANHTYDAAGAYNATVRVRDNRTEALLV
EETLRLNVTAAGSGTLVAAPDALTEGESVAFAVRNVSLAAGQSVGEYRWDFDGDGTADAT
TAANETAHAYADPGTYDAAVTAANANGTPLFTTSATVDVAAEEFAAPTDGWPQFGYDDAN
TGANVAGVGPAGPVEVRWNETTSTLYSRSPTFADGRVFVANGYGIVARDAANGSTLWSAS
AYPDEVTAPPTVEGDSVFVSSYNDAANNERDTLTVFDATDGTERWSVSVPADSDGLFTDG
ERLSAPTVTSDAVYVVSEAEDSLYAIDRGTRSLRWRKNLTELATTGNAQAVPAVANGTVY
VTQGWDGARYTGFGSHLYAFDADTGTERWNRSLSNHRGAAPTVSDGVLYVSTYGSLVAFD
AANGSTLWSAAAGETESRSSPAVADGVVVDTRGGYDDDEKGVVALAANGSRAWSYDTDSA
VLGAPAVLGDTVYVAEFDGTVHALDLQTGAPVWNDSLDAPGFDTTVASAVVGGDGWLYVQ
TGSSSDINRSLVALGDVEPLASVSGSLSATPANPRRAVENVTFETTASGDTASIDAYRWS
FGDGATAETTARNASHAYDRTGTYTARATGLDGYDRRLYTATTTVTVRDIGSADLRVTPT
PADVNVTNVSFAVTNRSFPASVTDVRYDWAFGDGETDFTAANRTTHTYATLGDAPVSVEV
LDGTTEQTLVTLSTTVPVVDRVPPTVSASAPSPVRTGANVTVTATATDNHRVANFTFETD
EGQSVTTAANRTNLSLATAGAHDITVTATDASGNSNATTIAVNASAAPDLEPRIEVEPAY
TLGNDRVTANVTVVNDGTAEATGVDVRLVARTRVGYYDDASTTYTRTVGTVAAGANETVT
VDLTDRLRGNLSSAYPDVELVAVSDPDDAVAEGDETDNRTAATTEVTYADLRLSVNAPWR
VIPTEAAETRVYVRNNGNAPNDPRTVELDFGDGSPNETLSVPALDPRESVVLTRNHTFAA
GRHAVVASVDDPDAPRGNSDGDATTSQPYELSGRLSAADPVQAGQNVTVYGRGYSNYESN
VTANLSLPAGLEFAAGETATKHDTDDRSYFEWTVVAAANRDATYDLELNLSARGETETAT
ERLTVERPKTRVVDTTAVNFTGTGGDSTTLALRNETTYEHDLTITTHLGTDGRTLAGLDY
LVRYPHACVEQTTSPMLGALYTGQYYRRNPAPGGYDSDRINDSVGAGVARLTTGQDAQHA
NGSWSMYGNDPDGDVFYTAYALFGTSAVGNDPVQSARAPVRADLDGIDANATVSWLAAEQ
AADGRIRNDKFYFDDDAAMTGFTLVALDQAGPYNATAAQTADRLRGDAASYLVAAQRADG
AWGEGSTPNTMSTALAVWGLEASGVETAAVQTAIDDGRTWLLDAQADGGAWTERRSASWS
DVGTTSETTAYALMALNATGLENTNASVQDGQTYLVTVYDDRGSWGYTRATALAINTLLT
LGQGGANPTHDVTVAFGTESNPALVTKTIDVDSTDALDSVELTESELQTLRDNADGPITV
QVDTTGTGVLVVGIENDQLVARDEYAANEGGA
Download sequence
Identical sequences M0I089
WP_007275935.1.100717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]