SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007325582.1.68031 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007325582.1.68031
Domain Number 1 Region: 175-556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-91
Family RecA protein-like (ATPase-domain) 0.0000000568
Further Details:      
 
Domain Number 2 Region: 2-138
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 2.35e-30
Family GSPII protein E N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007325582.1.68031
Sequence length 587
Comment type II/IV secretion system protein [Rhodopirellula baltica]; AA=GCF_000195185.1; RF=na; TAX=991778; STAX=265606; NAME=Rhodopirellula baltica WH47; strain=WH47; AL=Contig; RT=Major
Sequence
MKRIGDILVELNILTNEQMDAAFAGKPRGVMIGDWLVRQSLISNAQLGAALSEQFSVPFV
DIDFSSVNPQVARLLPEDFARSQASVAIDVSDRMLTLAMVAPDDIETIAEAELMTGYKIR
PVVALEDDVRDLLNRIYDDRAFARQTIVDMKFAEMAESGEVTEEDELAMSAVSQEDAPVV
KLVQAILSGAVSAGASDIHLEPHKPEMRVRYRVDGELQVVMTIPNHIEDSVISRIKVMGD
MDTTENRRPQDGHLTVYENGKRVGFRISGIPTVDGQKLVLRLLDEGGQTFDLAGIGMPQR
DYETIRRVIDKPHGMFVVTGPTGSGKSTTLYAALQHLNDDDRNIVTVEDPVEYRLPGINQ
VQSDNEFGMGFANALKYIMRQDPDVIMLGEIRDCETATTAVQAALTGHLVISTLHTNDAV
GAVQRLADLGVDNFKIAGSLLGSVAQRLLRCVCENCKVDAPANLNLLDALDPEQFVPRDT
TFVRGAGCKRCLGTGFAGRVPIFEIMPLNSDITAAIEAGVPNSQLEEMAHAAGMVPLRRA
GLEAAIAGKTSLEEVYFKTSGDRRSTNSTSMVGGRRSVDQPVPSAIA
Download sequence
Identical sequences F2APM1 K5E572 Q7UE44
NP_870051.1.48053 WP_007325582.1.68031 WP_007325582.1.98447 gi|32477057|ref|NP_870051.1| 243090.RB11595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]