SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007423550.1.41512 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007423550.1.41512
Domain Number 1 Region: 26-307
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.51e-93
Family Methylenetetrahydrofolate reductase 0.000000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007423550.1.41512
Sequence length 310
Comment MULTISPECIES: methylenetetrahydrofolate reductase [NAD(P)H] [Acidiphilium]; AA=GCF_000964345.1; RF=na; TAX=926570; STAX=62140; NAME=Acidiphilium multivorum AIU301; strain=AIU301; AL=Scaffold; RT=Major
Sequence
MSHTPPRAVLERWLSGPRVDPLPTPALRAPAPAISFEFFPPKTETLEAQLWACIRRLEPL
APRFVSITYGAGGSTQERTHATVTRLVRETTLVPAAHLTCVGASRGEVDDVARRYWDAGV
RHIVALRGDPPGGTAYAPHPEGYAYAADLVAGLRRVADFEISVAAYPETHTQAPSPQADL
DNLKRKLDAGATRAISQVFFETGHFLDFLDRALAAGITAPIIPGIMPVSNFGQAKRISEM
AGTHVPAWMGEMFDGLDDDAETRKMVAASIAAEQVRTLQANGIDEFHFYTLNRADLTYAI
ARILGVKPAR
Download sequence
Identical sequences A0A066PT21 A5FV15 F0J205 F7S7U5
gi|148259239|ref|YP_001233366.1| WP_007423550.1.19560 WP_007423550.1.41512 WP_007423550.1.67004 WP_007423550.1.88836 WP_007423550.1.96862 349163.Acry_0219 gi|326402392|ref|YP_004282473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]