SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007424913.1.67004 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007424913.1.67004
Domain Number 1 Region: 8-85
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 1.89e-19
Family VCA0319-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007424913.1.67004
Sequence length 99
Comment MULTISPECIES: hypothetical protein [Acidiphilium]; AA=GCF_000724705.2; RF=na; TAX=1464546; STAX=1464546; NAME=Acidiphilium sp. JA12-A1; strain=JA12-A1; AL=Contig; RT=Minor
Sequence
MATVAERKEYPISMRLPEADVAMIDRAASLRGRSRTDFVRDAAVRAAEEVVMEQGLIRMS
AEGFAEFMDVLARPAAPVPEMVEVLKRPAPWEPGYVAKR
Download sequence
Identical sequences A0A066PSN2 A0A257R124 A0A257S105 A5FTF4 F0J7K6 F7SBQ8
gi|325113269|ref|YP_004277215.1| WP_007424913.1.19560 WP_007424913.1.41512 WP_007424913.1.67004 WP_007424913.1.88836 WP_007424913.1.96862 gi|148243788|ref|YP_001220028.1| 349163.Acry_3271 gi|148243788|ref|YP_001220028.1|NC_009467 gi|325113269|ref|YP_004277215.1|NC_015178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]