SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007654684.1.100731 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007654684.1.100731
Domain Number 1 Region: 535-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.78e-31
Family alpha-mannosidase, C-terminal domain 0.062
Further Details:      
 
Domain Number 2 Region: 121-319,348-428
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000556
Family alpha-mannosidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007654684.1.100731
Sequence length 964
Comment glycosyl hydrolase [Parabacteroides goldsteinii]; AA=GCF_000307395.1; RF=na; TAX=999418; STAX=328812; NAME=Parabacteroides goldsteinii CL02T12C30; strain=CL02T12C30; AL=Scaffold; RT=Major
Sequence
MKKKIAYCLFASVLSSVIYADVVPSSVDYVVRPLYGYRADGTPGRIVTVKLKGKELKGEL
SVDVIAKGKTEKNHFALNAKDSTEVEILLPSTVPTGKKSEVTLVLRGADKVYKQKVSVTP
MRHWNVYLYNHAHVDIGYTNTHKNVEQLHKNNIIEGIKLAEETKNHPEGARYVWNPEIGW
PLERLWQSNPEMRDEVIDAIKKGQVCVDASYLNLNTSICTDEEMFHIFKFTREMQRLSGQ
PADVFQQFDIPGISWGLVPVMAQEGVRYIISWPNSDRAGNAHANMDGKPFWWLGPDGKSK
VLFFQPGSYANSGSMGKGGETGRPWFGQRDPKKVPKVIRTGYANVDFTKQLESMEKDNYP
YDFALFSWSLWDNNPLDADIPFAVKEWNEKYAYPKIRICGGHEIMSMIEDKYGDQLPVVS
GDYTEYWTDGLGTAAGLTAKNRNAKERLTQAETIWSMLADGGKAPRDDFDEAWRYILLGS
EHTWCFENPTEPYFQDAIWKVKQSYFHEAEDRSIDMLDESLAPATDKSNGALGPKEGPSN
GGIAVFNTHSWPQSGVIRLTAKESLKGDKVVDQHGKEVLSQRLSTGELLFYVPEVPALSS
RHFRVVEGKCSLSGSCKIEGTTLENDCLTVHVDQATGNIVSLLKKGSEYNYIGEGANTFS
WLPANVDAPQADTVLSVSVVEEGPLAVELRVVSKATGCRSVSRSVRLLAGQPWVEISNVV
DKLPLVEKDGIHFGFAFNLPDSKTRVDIPWGVMEVEKDQWPQGNRNWLAMQRWLDVSNAT
HGVTWCSLDAPLFEYGNRTANIALGWGDKGNWLKKLEPSSTIYSWVMNNHWHTNFPLTQD
GPVRFRYRLFPHEGYDVVKANRFGLEQSQPLVYATADKVQVVKPVIAIGNDRVYTTILKS
TDKDKELIVRLRSLSDKEESVKLSFPKADPKSLMICDREENPSRSTNGELTMIPYGQVTL
QLKY
Download sequence
Identical sequences K5YN04
WP_007654684.1.100731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]