SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007954418.1.54700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007954418.1.54700
Domain Number 1 Region: 88-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.37e-37
Family Phosphate binding protein-like 0.00000913
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.54e-19
Family LysR-like transcriptional regulators 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007954418.1.54700
Sequence length 309
Comment MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]; AA=GCF_001655595.1; RF=na; TAX=1534110; STAX=1534110; NAME=Pseudomonas sp. DR 5-09; strain=DR 5-09; AL=Complete Genome; RT=Major
Sequence
MTLTELRYIVTLAQEQHFGHAAERCHVSQPTLSVGVKKLEDELGVLIFERSKSAVRLTPV
GEGIVAQAQKVLEQAQGIRELAQAGKNQLTAPLKVGAIYTVGPYLFPHLIPQLHRVAPQM
PLYIEENFTHVLRDKLRNGELDAIIIALPFNEADVLTLQLYDEPFYVLMPAQHPWTQKES
IDAALLNDKSLLLLGEGHCFRDQVLEACPTLTKGNDGAKHTTVESSSLETIRHMVASGLG
ISILPLSAVDSHHYAPGVIEVRPLSAPVPFRTVAIAWRASFPRPKAIEILADSIRLCSVA
KPAAPVTAG
Download sequence
Identical sequences A0A0C2AFD4 A0A173JA48 A0A1G5NF69 A0A1G6D668 A0A2K4HQE6 J2XIP3 Q3K4K9
gi|77461779|ref|YP_351286.1| 205922.Pfl01_5558 WP_007954418.1.1491 WP_007954418.1.20937 WP_007954418.1.21389 WP_007954418.1.21564 WP_007954418.1.2668 WP_007954418.1.31280 WP_007954418.1.32803 WP_007954418.1.38776 WP_007954418.1.39127 WP_007954418.1.46342 WP_007954418.1.51676 WP_007954418.1.54387 WP_007954418.1.54700 WP_007954418.1.55686 WP_007954418.1.55771 WP_007954418.1.58385 WP_007954418.1.62013 WP_007954418.1.64081 WP_007954418.1.6588 WP_007954418.1.66386 WP_007954418.1.72974 WP_007954418.1.75567 WP_007954418.1.77688 WP_007954418.1.84829 WP_007954418.1.91175 WP_007954418.1.91687 WP_007954418.1.91867 WP_007954418.1.98588 WP_007954418.1.9994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]