SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007955684.1.55575 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007955684.1.55575
Domain Number 1 Region: 90-322
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.79e-43
Family Phosphate binding protein-like 0.0000000498
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000479
Family LysR-like transcriptional regulators 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007955684.1.55575
Sequence length 324
Comment MULTISPECIES: transcriptional regulator CysB [Pseudomonas]; AA=GCF_002112605.1; RF=na; TAX=1981699; STAX=1981699; NAME=Pseudomonas sp. R22(2017); strain=R22(2017); AL=Contig; RT=Major
Sequence
MKLQQLRYIWEVAHHDLNVSATAQSLYTSQPGISKQIRLLEDELGVEVFARSGKHLTRVT
PAGERIITTAGEILRKVESIKQIAQEFSNEKKGTLSIATTHTQARYALPPVISNFIKQYP
DVALHMHQGSPMQIAEMAADGTVDFAIATEALELFGDLVMMPCYRWNRCVVVPQGHPLTK
LPKLTLEALAEYPIVTYVFGFTGRSKLDEAFSHRGLTPKVVFTAADADVIKTYVRLGLGV
GIVAKMAVDTKLDNDLVVLDASELFESSVTKIGFRRGTFLRGFMCDFIEKFAPHLTREVM
AKAIQCHNKQELEELFEGVELPVH
Download sequence
Identical sequences A0A0N9VX74 A0A2K4HA22 A0A2K4K712 J2P9X7 Q3K914
205922.Pfl01_4003 gi|77460224|ref|YP_349731.1| WP_007955684.1.15864 WP_007955684.1.21564 WP_007955684.1.2668 WP_007955684.1.32803 WP_007955684.1.46058 WP_007955684.1.47299 WP_007955684.1.53106 WP_007955684.1.55575 WP_007955684.1.55954 WP_007955684.1.58965 WP_007955684.1.64527 WP_007955684.1.66221 WP_007955684.1.8936 WP_007955684.1.96080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]