SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007956792.1.58965 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007956792.1.58965
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.02e-95
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000401
Further Details:      
 
Domain Number 2 Region: 280-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.18e-33
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007956792.1.58965
Sequence length 403
Comment MULTISPECIES: cytochrome b [Pseudomonas]; AA=GCF_002112965.1; RF=na; TAX=1981726; STAX=1981726; NAME=Pseudomonas sp. B31(2017); strain=B31(2017); AL=Contig; RT=Major
Sequence
MSKFMDWVDARFPATKMWEDHLSKYYAPKNFNFFYFFGSLALLVLVNQIVTGVWLTMSYT
PSAEEAFASVEYIMRDVEYGSILRLLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWV
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGNDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKHKDENGIPLDGIAFHPYY
TVKDIVGVVVFLFIFCFIVFFFPEMGGYFLEKPNFEQANPFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVKSMRYKGWMSKIWLVVFCISFVILGILGV
LAPTPGRTLLSQVCTFLYFAYFILMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A173J7M1 A0A1G5M8Q4 A0A1G6EER1 A0A2K4H9K1 J3F6J8 Q3K726
WP_007956792.1.15864 WP_007956792.1.20937 WP_007956792.1.21564 WP_007956792.1.2668 WP_007956792.1.32803 WP_007956792.1.38776 WP_007956792.1.53106 WP_007956792.1.54387 WP_007956792.1.54700 WP_007956792.1.55771 WP_007956792.1.58965 WP_007956792.1.62013 WP_007956792.1.6588 WP_007956792.1.72974 WP_007956792.1.75567 WP_007956792.1.84829 WP_007956792.1.91867 WP_007956792.1.96080 WP_007956792.1.98588 205922.Pfl01_4691 gi|77460912|ref|YP_350419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]