SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_007958716.1.2668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007958716.1.2668
Domain Number 1 Region: 94-299
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.93e-37
Family Phosphate binding protein-like 0.00085
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-21
Family LysR-like transcriptional regulators 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007958716.1.2668
Sequence length 304
Comment MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]; AA=GCF_000012445.1; RF=na; TAX=205922; STAX=294; NAME=Pseudomonas fluorescens Pf0-1; strain=Pf0-1; AL=Complete Genome; RT=Major
Sequence
MAAYNLRQLKYFITTVECGSVAEASRKLYIAQPAISTAIKGLEDSFGVQLLIRHHAQGVS
LTPSGARFFRKAQELLRMAKEFEQNALADNDVVAGQIDIGCFETVAPLYLPQLIAGFSAL
YPGVKIRIRDGEQQELVQGLTSGTFDLAILYKHDLDATIETEPLMPAQRPYALLPADHRF
AQLKQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLSPRIEFSSPSIEMVRGMVGQGFG
FSILVTRPHSECTYDGKKVVCVDIVEDVTGSGLVAAWLKRGQLTKPAQLFADYCREQLTA
KASR
Download sequence
Identical sequences A0A0C1W3S1 A0A173J7N6 A0A1G5NYB4 A0A1G6EX41 A0A2K4HVL1 J3F309 Q3K6D3
205922.Pfl01_4934 WP_007958716.1.15864 WP_007958716.1.20937 WP_007958716.1.21564 WP_007958716.1.22023 WP_007958716.1.26239 WP_007958716.1.2668 WP_007958716.1.30523 WP_007958716.1.46399 WP_007958716.1.47897 WP_007958716.1.53106 WP_007958716.1.54700 WP_007958716.1.58965 WP_007958716.1.6588 WP_007958716.1.75567 WP_007958716.1.91687 WP_007958716.1.96080 gi|77461155|ref|YP_350662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]