SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008096231.1.35995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008096231.1.35995
Domain Number 1 Region: 661-901
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.42e-31
Family Quinoprotein alcohol dehydrogenase-like 0.0027
Further Details:      
 
Domain Number 2 Region: 1555-1847
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.02e-27
Family Terpene synthases 0.029
Further Details:      
 
Domain Number 3 Region: 525-700
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.32e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0036
Further Details:      
 
Domain Number 4 Region: 437-515
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000589
Family PKD domain 0.0017
Further Details:      
 
Domain Number 5 Region: 308-415
Classification Level Classification E-value
Superfamily PKD domain 0.000000000157
Family PKD domain 0.0044
Further Details:      
 
Domain Number 6 Region: 927-996
Classification Level Classification E-value
Superfamily PKD domain 0.000000000275
Family PKD domain 0.0028
Further Details:      
 
Domain Number 7 Region: 1011-1082
Classification Level Classification E-value
Superfamily PKD domain 0.00000576
Family PKD domain 0.0068
Further Details:      
 
Domain Number 8 Region: 1089-1170
Classification Level Classification E-value
Superfamily PKD domain 0.0000419
Family PKD domain 0.011
Further Details:      
 
Weak hits

Sequence:  WP_008096231.1.35995
Domain Number - Region: 251-324
Classification Level Classification E-value
Superfamily PKD domain 0.000981
Family PKD domain 0.021
Further Details:      
 
Domain Number - Region: 141-193
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0192
Family Carboxypeptidase regulatory domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008096231.1.35995
Sequence length 1939
Comment hypothetical protein [Haloferax prahovense]; AA=GCF_000336815.1; RF=na; TAX=1227461; STAX=381852; NAME=Haloferax prahovense DSM 18310; strain=DSM 18310; AL=Contig; RT=Major
Sequence
MTTRYRHQVGAASLTIIVLVSLASPFVALSGAAAGQSLAGSVDRATGAPAASDVVFAATD
GSEPSYDELSAQGAYNLTGLQSNATYDVSYLAANGSQPGAPGAFPRDGSPDVFALQRASP
GATADLGNAALPGAHVVNLSVVNETGAPVSGAAVAFQHTNANGATVNTSQFGEWFLTEAD
GDVHLSNGTAGIELTGNVTVAVAPPRQLSYDGGLEGEPVSSSSGYVQRVYTTRLDVTGDE
TVTVTLESAEQPGATMTANETAPALGEPVNVSLSNITGETPSFYTWTVDGSYAGYTTHPN
ASLVLPGFSAPGPHTVAVTARSGSEQFLFEESLTLDAVTAGDGTLTAAPTPARANLDTVR
FALVNVSGVGDGDFYTWTFGDGDRTYTRHPNATANHTYAEPGAYNATVRVRDNSTEALLV
EDTLRLDVTAAGNGTLVATPDSLTEGESVAFAVRNVSLAAGQSVGEYRWDFDGDGTADAT
TAANETSHAYADPGTYDAAVTVTNANGTPLFTASAAVDVAAEEFAAPTDGWPQFGYDDAN
TGANVAGVGPAGPVEVRWNETTSTLYSRPPTFADGRVFVASGYGIVAYDAANGSTLWSAS
AYPDEVTAPPTVEGDSVFVSSHNDAANNERDTLTVFDAADGSERWSVSVPADSDGLFTDG
EWLSAPTVTSDAVYVVSEAEDALYAIDRGSHSLRWRKNLTELETTGDAQAVPAVANGTVY
VTQGWDGSRFTGFGSHLYAFDADTGTEQWNRSLSNHRGAAPTVSDGVLYVSTYGSLVAFD
ADTGAQLWSVAAGETESRSSPAVADGIVVDTRGGFYDDEKGVVAVATNGSRAWSYDTDSA
VLGAPAVLGDTVYVAEFDGTVHALDLQTGAPVWNDSLDAPGFDTTVASAVVGGDGWLYVQ
TGSSSDINRSLVALGDVEPLASCLLYTSXFETTVSGDADSVETYRWSFGDGATAETTARN
VSHAYDRTGTYTARVSGFDSYDRKLYTATTAVTVRDIGSADLRVAPTPADVNVTNVSFAV
TNRSLPASVTDVRYGWSFGDGETVFTSANRTNHTYAALGDAPVSVEVLDGTTEQTLVTLS
TTVPVVDRVPPTVSASAPSPVRTGGNFSVVASATDNHRVANYTFETDEGQSMTTAANRTN
LSLATAGAHTVTVTATDASGNSNATTLVVNASAAPDLEPRISVEPAQTLGNDRVTANVTV
VNDGTAEATDVDVRLVARSRVGYYDDASTTYTRAVGTVAAGANETVTVDLTDWLRGNLSS
AYPDVELVAVSDPDGAVAEGDETDNRTTATTEVSYADLRLTVNAPWRVIPTEAAETRVYV
RNYGNAPSDARTAELDFGDGSSNETLAVPALDPRETAVFTRNHTFATGRHTLVASVADPD
APRGNADRDVTTSQPYELRGRLSAADPVQVGRNVTVYGRGYSNYESNVTANLSLPAGLEF
APGETATKYDTDDRTYFEWTVVATANRDATYDLELNLSARGENETATERLTVERPKTRVV
DTAAVNFTGTGSDSATLTLRNETTYEHGVTISTHLGTDGRTLAGLDYLVEYPHACVEQTT
SPMLGALYTGQYYRRNPAPGGYDTGQINASVDAGVARLTTGQDAQHENGSWSMYGNDPDG
DVFYTAYALFGTSAVGNDPVQSARAPVRADLDRIDANATVAWLADEQAADGRIRNDKFYF
DDDAAMTGFTLVALDQAGPYNATAAATADQLRGDAASYLVTAQRADGAWGDGSTPNTMST
ALAVWGLEASGVETAPVRTAIDDGRAWLLDNQADSGAWSQRRSASWSDVGTSSETTAYAL
MALNATGLENTNASVQAGQTYLVTVYDDRGSWGYTRATALAINTLLTLGQGGSNPTHDVT
VTFGTESTPALVTKTIDVDSTDALDSVELTESELQTLRDNADGPITVQVDTTGTGVLVVG
LENDQLVARDEYAANEGGA
Download sequence
Identical sequences M0G2B4
WP_008096231.1.35995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]