SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008449901.1.64370 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008449901.1.64370
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008449901.1.64370
Sequence length 180
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella amnii]; AA=GCF_000177355.1; RF=na; TAX=679191; STAX=419005; NAME=Prevotella amnii CRIS 21A-A; strain=CRIS 21A-A; AL=Contig; RT=Major
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRIS
SPILSKYDVAIVLNQPSLDKFEEKVKPGGILIYEGNGIINPPTRTDIEIYRIDAVEKAAE
LKNSKVFNMIVLGGLLGVCPVVSNNGLEKALYKTLPERHHGLIPLNMQAVDEGKKIIRKQ
Download sequence
Identical sequences A0A096AY51 A0A134BGT4 E1GWW4
WP_008449901.1.100740 WP_008449901.1.32967 WP_008449901.1.45999 WP_008449901.1.64370 WP_008449901.1.96508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]