SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008621854.1.53855 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008621854.1.53855
Domain Number 1 Region: 507-963
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.73e-30
Family alpha-mannosidase, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 109-311
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.34e-16
Family 4-alpha-glucanotransferase, N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008621854.1.53855
Sequence length 965
Comment glycosyl hydrolase family 38 protein [Paraprevotella clara]; AA=GCF_000233955.1; RF=na; TAX=762968; STAX=454154; NAME=Paraprevotella clara YIT 11840; strain=YIT 11840; AL=Scaffold; RT=Major
Sequence
MRLQNLFLGMFLWGAAIHPVCSAASPVLQTKLHPAVYKSSSGPVRRVAVTVGYDGQAAEV
ELALGRQVRRVRLEEGENHFEFDIPDAGTDRTLPLSLRAGQVSWASDEVKVPVARHWQMN
LVQHTHTDIGYTRSQMEILAEHLRYIDYALDYCDATDHYPDAARFRWTCEVAWPVKEYLK
NRPTSQVERLKRRVKEGRIELGAMYLNFDELPDEQTLAASLAPLKLFRDEGLRADLAVQD
DVNGIAWCFSEYFADAGVKYLNMGTHGHRALICFDKPTVFWWESPSGKKILAYRAEHYHL
GNYWGVHNPDDFTKFEQCVWDYLGQLEAKGYPYDICAIQHSGYLTDNAPPSTRSCEMVKR
WNEKYEWPKLRTAVATDFIKTVERDYAAQIPVIRGAWPDWWTDGFASGAREAAVSRATHS
HAIAGQGGLALAKLAGAELPQGVMGKVSDMNEALLFYDEHTFGYCESVRDPYGRETWEQR
SLKQSYAWEAYRHAGLLGETVMGLLQSFVPKTDVPSVAVFNTLNWSYSGIAKVYIDHQLL
PRDKVFEITDASGRSVPAQAGESRSDGTYWYIYVRDVPALGFARYRIDVKDEPRPSGASA
GSLSGTHVENEWYGLDFNLQRGTISRLYDKDLQRQLLTESAEWELGEFIYETIDDRGALE
RYTYPRFTRRHPEKMRFEAYEEGAIWDTYRFKGETAAGMGHDNLTVEYHIYKVEKKIEVV
YSLRKKTETEPEAVYVSFPYQIEDGRIFLDVPGGNIEAGVDQIPGSSNDWYTVQNFAAAR
SSDVQVVMGSPEIPLMQFGAINTGRYQAGAVPQTTNMYSWPMNNYWTTNFNAGQTGGLQW
SYFITSSADTTAGFATRFAWENRIPFLARVLQAGDCEDKDAPSCGTFLTLRPDNLLLVNM
APVEGERAVMLHLRETDGWPAAFAVTSDEVKIRKVTVCDVTGRPVGGRDEAEFNPWESKF
IKLSW
Download sequence
Identical sequences G5SUA2
WP_008621854.1.53855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]