SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008626866.1.59794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008626866.1.59794
Domain Number 1 Region: 536-968
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.83e-34
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 121-141,170-319,345-429
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000541
Family alpha-mannosidase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008626866.1.59794
Sequence length 969
Comment glycosyl hydrolase [Paraprevotella xylaniphila]; AA=GCF_000205165.1; RF=representative genome; TAX=762982; STAX=454155; NAME=Paraprevotella xylaniphila YIT 11841; strain=YIT 11841; AL=Scaffold; RT=Major
Sequence
MKRNFFCGMLAVLAAGNVNADVVPEQVSCVVKPLYGYRQDRSPGRIVAVRLKGAELKGEV
CVDVAYRKLKETSAFRIDAEDSAEVEVMLPSALPVDKTVDVSLTVRGTEKKVKTKVTVEP
MRHWTVYLYNHSHVDIGYTNTHKNVEMLHKTNVKEGMKLSHETVGHVDGARFVWNPEVTW
PIERLWNSEPGMRDEIIASIKGGGLSVDASYLNLNTSICSDEELFHVFKFSRELQRLSGV
PADVFQQFDIPGISWGLVPVMAQEGIKYVISWPNTDRGGNAHSFGIDGFPFWWVGPDGHS
KVLFLQPGKYANSGSMDKGNTTGRPWFGQRNARKVPARIQMGSANVDFTGQLVDLEKKNY
PYDFIVLSWSLWDNNPVDADVPYAVNEWNKKYAYPKIVISGGHEVMKTLEEKYGDRLPVV
HGDYTEYWTDGLGTAARLTAVNRRNKERITQAETVWSMLAGGACAPRAEFDEGWRYILLG
SEHTWDFENPWEPYFHEAISKVKQSYFYEAEARSMTLLDEALGLATDKSNGALGPREGPS
NGGIAVFNTLSWPHGGLVTLSSSESQKGDKVVDDVGNAVPSQRLSTGELAFWASDVPALG
SRHYRVVEGDAVPGDACKLDGYTLDNGCVRVTIDGKTGNIVSLTRAGEDYNYIDASVDGG
ANSCSWLPANENKPEADKVQAITVTEQGGLVVELKVQSMMKGCRSVTRTVRLVAGQPWVE
TTNVVDKLPLLDKDGIHFGFGFNVPQGVTKVDIPWGIMEVEKDQWPQANRNWMALQRWLD
VSNDTHGVTWCALDAPLFEYGDRTANISLGWGGQGPWLTKLEPSSTVYSWAMNNHWHTNF
PLTQDGPVAFRYRIHPHGGYDAVDANRFGLEQAQPLVHVTADKNPDVKSVISVDNRAVYV
TVLKSTEKDNEMIVRLRSVSDREETVALDFPAHRPSSVSLCTLEEQPGQIVDGTLTMKPY
GMATLKLTF
Download sequence
Identical sequences F3QTW1
WP_008626866.1.59794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]