SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008760147.1.67099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008760147.1.67099
Domain Number - Region: 16-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00202
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008760147.1.67099
Sequence length 89
Comment MULTISPECIES: transcriptional regulator [Bacteroides]; AA=GCF_000403155.2; RF=na; TAX=1235785; STAX=818; NAME=Bacteroides thetaiotaomicron dnLKV9; strain=dnLKV9; AL=Scaffold; RT=Major
Sequence
MEQKICQCCAMPIDETTFGTEADGSKNEEYCQYCYADGHFTKECTMDEMIELNLNYLEEF
NKDSEVKYTIEEARATMKEFFPQLKRWKQ
Download sequence
Identical sequences A0A0P0F7Y4 A0A1H7X1K6 C6IKZ8 D7I961 Q89Z82 R7KXF2 R9H8G4
NP_813406.1.73244 WP_008760147.1.19130 WP_008760147.1.28290 WP_008760147.1.29471 WP_008760147.1.52087 WP_008760147.1.54521 WP_008760147.1.58123 WP_008760147.1.59332 WP_008760147.1.59346 WP_008760147.1.67099 WP_008760147.1.81417 WP_008760147.1.83447 WP_008760147.1.97929 APC82184 226186.BT_4495 gi|29349903|ref|NP_813406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]