SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008774287.1.90444 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008774287.1.90444
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-34
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 115-323
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.28e-20
Family alpha-mannosidase 0.045
Further Details:      
 
Weak hits

Sequence:  WP_008774287.1.90444
Domain Number - Region: 59-130
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.058
Family Ribosome recycling factor, RRF 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008774287.1.90444
Sequence length 962
Comment MULTISPECIES: hypothetical protein [Bacteroidales]; AA=GCF_000699745.1; RF=na; TAX=1339341; STAX=823; NAME=Parabacteroides distasonis str. 3776 Po2 i; strain=3776 Po2 i; AL=Contig; RT=Major
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDIKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSHKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEETTVTVKPIRHWQMN
MVQHTHTDIGYTRSQMEILAEQLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPVEQIARLKQRVKEGRIELATMFLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYHY
GNFFGIHTDNFDQFEERVLTYLGEMEAKNYPYDILAVQHSGYLTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADHIQTIRGAWPDWWTDGFASGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIQDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDAAGNVIPAQAGESRSDGTYWNFYVKEVPALGYAQYYIKVKDAPRPEIQGAT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLRSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKSATFSVASDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences A0A069SI66 D0TJF9
WP_008774287.1.80225 WP_008774287.1.88798 WP_008774287.1.90444 WP_008774287.1.94048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]