SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008878634.1.10946 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008878634.1.10946
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-87
Family Protein kinases, catalytic subunit 0.00000116
Further Details:      
 
Domain Number 2 Region: 510-571
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  WP_008878634.1.10946
Domain Number - Region: 374-434
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000876
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008878634.1.10946
Sequence length 665
Comment MULTISPECIES: serine/threonine protein kinase [Geobacillus]; AA=GCF_001412125.1; RF=na; TAX=1699078; STAX=1699078; NAME=Geobacillus sp. PA-3; strain=PA-3; AL=Contig; RT=Major
Sequence
MLIGKRLNDRYKIISLIGGGGMANVYLARDIILERDVAVKVLRLDFANDEQFIKRFRREA
QAATSLNHEHIVSIYDIGEEEGVYYIVMEYVRGATLKQYIQQYAPLPVEQALRIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEDGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGVVMFELVTGRLPFSGESAVSIVLKHLQEETPSPKDWNPEIPQS
VENIILKAMAKDPFYRYPSAQEMNEDIRTALDPRRRNEAKFTIPDDDEATKVIPVMKRPE
SAALEQETIIDEEKVSESAKTADEPKQKPKPKPKPKSKRKRMWITWLAAALLLLGVVGVS
ALTWIPDLVFPKDVTIPDVTNKEYDEAVEELSALGLEIKDTIDVEDDTIEEGKVVRTDPE
AGMTVKPGAGVVIYKSVGKKKIEFPSFIGDEISVAEEELRAEGFTRITRNGRYSDKPEGT
ILDQYPYAGDEVVPDETEVIFTVSLGPEKVRLKDLTGYTEKSVRDYVEDQGLRIEVTYEH
SDDVPEGLVISQTPAAGEQVEKGKTITVVISRGPEPKPSKTVVKEITVPYEPAEEGQIVK
AQLYIQDANHNMTTPYKTYQLTQSVTETVEFEIPYGETAYYRVIVNNVVKDEGTIPYPEN
GGKKE
Download sequence
Identical sequences A0A0Q0ZSI7 A4IM51
WP_008878634.1.10634 WP_008878634.1.10946 WP_008878634.1.76507 420246.GTNG_1029 gi|138894697|ref|YP_001125150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]