SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008881431.1.26402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008881431.1.26402
Domain Number 1 Region: 4-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.64e-62
Family ABC transporter ATPase domain-like 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008881431.1.26402
Sequence length 229
Comment MULTISPECIES: lantibiotic ABC transporter ATP-binding protein [Geobacillus]; AA=GCF_002243605.1; RF=na; TAX=169283; STAX=169283; NAME=Geobacillus lituanicus; strain=N-3; AL=Complete Genome; RT=Major
Sequence
MGEYMLETHHVSKAFGKQLVVDDVSIKVKKQTVYGLLGPNGAGKSTLLKMLTGLLRPTKG
EIMINGHPWSRKDLKDIGVLIESPALYGNLTAHENLLVHAKLLHLPESRIQEVLNIVGLE
NTGKKKASQFSLGMKQRLGIAKALLNHPKLLILDEPTNGLDPLGIQDLRKLIQSFTENGI
TVILSSHILSEVKQLADYIGIIQNGKLRYEGKIDESQDLEKLFVDVVNE
Download sequence
Identical sequences A0A098L6B1 A0A0J0V9K5 A0A0Q0UN38 A0A142D5K5 A0A1V9BS22 A0A1W6VMT3 A0A223DXL3 A0A2D1K531 A0A2H5KHJ9 G8N3N5 Q5L383
gi|56418847|ref|YP_146165.1| 235909.GK0312 WP_008881431.1.10946 WP_008881431.1.2219 WP_008881431.1.26402 WP_008881431.1.41580 WP_008881431.1.45808 WP_008881431.1.57889 WP_008881431.1.65208 WP_008881431.1.70239 WP_008881431.1.76507 WP_008881431.1.78869 WP_008881431.1.8599 WP_008881431.1.86012 WP_008881431.1.90235 WP_008881431.1.91533 WP_008881431.1.93593 gi|375007190|ref|YP_004980822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]