SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_008999001.1.98721 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008999001.1.98721
Domain Number 1 Region: 80-195
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000122
Family PKD domain 0.0026
Further Details:      
 
Domain Number 2 Region: 197-591
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000576
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 3 Region: 27-109
Classification Level Classification E-value
Superfamily PKD domain 0.0000589
Family PKD domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008999001.1.98721
Sequence length 617
Comment protease [Bacteroides sp. D2]; AA=GCF_000159075.2; RF=na; TAX=556259; STAX=556259; NAME=Bacteroides sp. D2; strain=D2; AL=Scaffold; RT=Major
Sequence
MKRIIYLLIAAVSLLVGCNPAEEAWVQAGFTTDKESYEIGDLITLTNTSTAENAQIAVCK
WEFMGKVSYELAAPEPFSVEEGGDYLFRLTVTSDHGSMKSVFEKTIKIIDDGIRPTADFS
WLPEQIVAGEEVVFTDQSKAAEGCEIIKREWTFGAILSTEENPTVTFGSHGKINVSLTVT
DNKKRKDTKTVTVDVAKSAGSLGVLWAHSYDEQGVVIGTSPATSADGEYVYVSSSNYNLV
CFTKLGERVWGFDCGQNNEPNRGSDYQHPTPTVDSDGVVYVAVGDNTSKADAAKSASLYA
VKGGADGGTQKWFTSIGAKSSMRPFGAPVVTDRYVMILTNSAPSTDGMHFRIYDKASGVL
QYAEKTSSGSYGGCVGLKDGRVLVNTGQSGGRSYGTHIFFPKGNSWSKSTNEQNYAPNDQ
PNGSQIAVGADGKAYILCLNLGARISTNETKALVYCYDTKKTTEGNVSAPEWYTAVKGEN
KQTGYGLVVDGNGVVYVATDKYITAISSTGSVLWATEVAGTAYGVPAIDNEGYIYYNDTE
KGSLVKLEPATGKAIASLQLGTGLQSSPTISADGIIYVTGMLEGKPTLFAVEGAATGYAA
NAWSQMGGNPGKSGYMY
Download sequence
Identical sequences E5CDW3
WP_008999001.1.98721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]