SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009206596.1.13230 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009206596.1.13230
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.22e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 7.72e-26
Family Ribosomal protein L11, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009206596.1.13230
Sequence length 143
Comment MULTISPECIES: 50S ribosomal protein L11 [Sulfuricella]; AA=GCF_000297055.2; RF=representative genome; TAX=1163617; STAX=649841; NAME=Sulfuricella denitrificans skB26; strain=skB26; AL=Complete Genome; RT=Major
Sequence
MAKKIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGLEVGLPIPVVIT
AYADKSFTFIMKTPPATVLIKKASGVQKGSPRPHTDKVGKLTRAQAEDIAKAKMPDLTAS
DMDAAVRTIAGSARSMGIEVEGV
Download sequence
Identical sequences A0A0E9MH38 S6AF30
WP_009206596.1.13230 WP_009206596.1.60282 gi|543962453|ref|YP_008545488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]