SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009274969.1.56575 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009274969.1.56575
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.67e-33
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 112-323
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.67e-21
Family alpha-mannosidase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009274969.1.56575
Sequence length 962
Comment MULTISPECIES: hypothetical protein [Parabacteroides]; AA=GCF_000307475.1; RF=na; TAX=658661; STAX=658661; NAME=Parabacteroides sp. D25; strain=D25; AL=Scaffold; RT=Major
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDIKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSRKEKLASGDNVFRIEIPEVSATRQLPLTLTSGKEKEESTVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEQLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPAEQIARLKQRVKEGRIELATMFLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYHY
GNFFGIHTDNFDQFEERVLTYLGEMEAKNYPYDILAVQHSGYLTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADRIETVRGAWPDWWTDGFASGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIYDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDAAGNVIPAQAGESRSDGTYWNFYVKEVPALGYAQYYIKVKDAPRPEIQGTT
ELKETHVENPWYAIDFNTRKGTIRKLCDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKRAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVASDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences K6AVU9
WP_009274969.1.29417 WP_009274969.1.56575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]