SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009597720.1.14540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009597720.1.14540
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Flavoproteins 4.68e-44
Family Flavodoxin-related 0.000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009597720.1.14540
Sequence length 163
Comment MULTISPECIES: flavodoxin [Alistipes]; AA=GCF_000312145.1; RF=representative genome; TAX=1033732; STAX=1288121; NAME=Alistipes senegalensis JC50; AL=Scaffold; RT=Major
Sequence
MTGIFFGSTMGTTEAVAADIAKQLGVADADVHNVADTPAGEVQKYDLLVLGSSTWGAGEL
QDDWYGFLDQLKAQDLSGKKVALFGCGDSGSYPDTFCDAVGLIYDGLQQSGCTFVGAYAP
EGYDETGSLVCRGGKFVGLAVDESAPDKTDRRVAAWCEQIKNE
Download sequence
Identical sequences A0A173Y490 E4MBS9 I3YR20
WP_009597720.1.14540 WP_009597720.1.48748 WP_009597720.1.56960 WP_009597720.1.76885 WP_009597720.1.9852 gi|390948363|ref|YP_006412123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]