SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009597779.1.9852 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009597779.1.9852
Domain Number 1 Region: 727-1139
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-24
Family alpha-mannosidase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 323-496
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000148
Family alpha-mannosidase 0.055
Further Details:      
 
Weak hits

Sequence:  WP_009597779.1.9852
Domain Number - Region: 104-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00194
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009597779.1.9852
Sequence length 1164
Comment glycosyl hydrolase family 38 [Alistipes sp. HGB5]; AA=GCF_000183485.2; RF=na; TAX=908612; STAX=908612; NAME=Alistipes sp. HGB5; strain=HGB5; AL=Contig; RT=Major
Sequence
MKKLLLLWLLTLATTVAVHAQRVEIYRQLPSDQITASASSTLRGSSATAAVDGAGMRGDL
HEANNLGHGMWVSQASAETVRYSPSTREGVVWFLCQVGDKNSPPRQIDQIRIWNHNQNEH
TRRGLNKVYIEYSADGQTWQLLPDGRLDYHVIPESVGRNPEPADLILNTPGLKARYICFT
AAAGGEGNHYDRNDPVVMREAADMHQNPDYYGLAEIRFYTKERADVRTLAPVSELSFAAS
QGYLKTPEGPSREFTLRFDNPIYAGADLAFECGGRTWSAEIAPSGVGVVRYDGLFPAGYM
EETAKLVVRLTSRQGTVEKRFEVPAARKWTVNFLSHSHQDIGYTHRQMDVMKFQWRNLER
AMDLAERTKDYPEGARYRWNTEATWAIAGYLEAYAGTDKAARLIQAVRDGVINIDAPLGS
ILTGICRQEELMHMFDDAHRLAREIGVEVNTAMMSDVPGQVWGLATAMSKNGVKYYSPGP
NYVPFYGKIGNDRAAALHVEWGDRPFYWLSQSGTDKVLVWQAGRGYSWFHGWLAGRLSVC
GVEPIWNYLQELETDEFPYNTCYLRYTVHGDNGPPDELMPDVIRAWNERYDSPQFRITTT
KEFFTAFEEQYGEYLPTYGGDMTPTWEDGASSTARETAMNRESAARLTRTGILWSMLSPE
SDYPARELAEAWKNVLLFSEHTWGASASGPDPYSQFTKDLWAGKKMYADSADVQSRRLCD
EAMAGITAGEGYVQVLNTNLWPRTDVVTVAADLTGKRLLAPSGEPVAVQRLHDGGWIFLA
EEEPALSSSVYRIVPAKTSAKAKKSLEAPVSMIGGNVLDNGLVRVAVDPAKGTIRSLKAA
GADYEYAAGEGLNDYIYSGRIAADPRGIDRVTRVEVLDDGPVAATLRIVSDAPGCNALWR
DVTVYRGLGRVDIRNTVDKQDILEHESVRFVFPFNFAHPEITMDLAMSEMHPEREQLAGV
NKHYYSLLNGMAVGDLEHAVCLTTLDAPFVELGTPSGEDYRLNPRHGYGWWPSAQISPVV
YSWVMNNTWRTNYKASQGGVASFRYSLQISDPFDLKLKQRGAEREQPLIAVESGRPEPVG
RLFRLEGRNRIAVSGIAPSADGTGYIVRLQNMGDQSVHSAFVWGRMKARRVSVCDYREQP
LAPFDDRSFWMKPFEYLMLKVETE
Download sequence
Identical sequences E4MC30
WP_009597779.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]