SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009598263.1.9852 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009598263.1.9852
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Flavoproteins 1.27e-34
Family Hypothetical protein YwqN 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009598263.1.9852
Sequence length 179
Comment MULTISPECIES: FMN reductase [Alistipes]; AA=GCF_000183485.2; RF=na; TAX=908612; STAX=908612; NAME=Alistipes sp. HGB5; strain=HGB5; AL=Contig; RT=Major
Sequence
MAKKVLILSSSPRRGGNSDLLCDRFMAGAQQAGHDVEKIFLRDKKINYCTGCGVCYGGAK
PCPQRDDAAEVVGKMIGAEVIVMATPVYFYTLCAQMKTLIDRTCARYTEMGGKEFYFILT
AAEESVEMMERTVECFRGFLDCLDDPEERGVVYGVGAWQAGEIEGMPAMDEVYELGRRV
Download sequence
Identical sequences A0A1Q6FQ47 E4MCW7 I3YR45 R5V0A6
gi|390948388|ref|YP_006412148.1| WP_009598263.1.56960 WP_009598263.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]