SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009599042.1.9852 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009599042.1.9852
Domain Number 1 Region: 122-206
Classification Level Classification E-value
Superfamily PKD domain 4.97e-22
Family PKD domain 0.0032
Further Details:      
 
Domain Number 2 Region: 208-388,444-580
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000334
Family Quinoprotein alcohol dehydrogenase-like 0.0051
Further Details:      
 
Domain Number 3 Region: 48-119
Classification Level Classification E-value
Superfamily PKD domain 0.00000000017
Family PKD domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009599042.1.9852
Sequence length 617
Comment hypothetical protein [Alistipes sp. HGB5]; AA=GCF_000183485.2; RF=na; TAX=908612; STAX=908612; NAME=Alistipes sp. HGB5; strain=HGB5; AL=Contig; RT=Major
Sequence
MKRILSYLSIVLLSASVACSDSSEMDKAYNSVITPGFTFGEEEIIAGITPVTFTNTTTAE
GTTVSEYFWHFGFAGEGNWSEEAAPDPIVYNRPGDYTVTLTAWGADGNRATTTRTITVLA
DNVLPTADFSYSPQMISIGTTVTFTDKSTDSDGEIVSREWLFPDGTTSTDINATYTFEQM
GMFNVQLTVTDDRGGSNSTSKAINVRAGDVNAFTLLWSTAVASADALCAASVVAASDMGY
IYSVSGDGKMVALNTDGAKVWEYDAMAKDGVYLKSEISYPSADTDGTVYWVAHGYGGSSS
ASLVYAFDGATGSVLWKNTTAYAPAARIAFSTPCISPSMVIVGSRGTNGAIRGFEKGTGK
NTATATPANGGGTSGTIALKNGVVIFTNTAQYGYGIMVPDASFVWSPVPTSDTFAPNKIL
SAGRCQPCVDADNCVYLPGIAEGSGTWNLASFDCTNLTASSKKTPKWSVNLPDGFQQTGA
SLSADGTTLYIVADKATPSVVYALNTSNGSTRWSYTLDAASNSIPAVDNLGQIHLCTKTG
DYVVLSAEGELRYKEHLADSVDGSPTISEWGYSYFLGKDSAAGALKVYSVALPGVTSPAA
SAWSQYGQNARHSNYQK
Download sequence
Identical sequences E4MFD2
WP_009599042.1.9852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]