SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009871603.1.14984 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009871603.1.14984
Domain Number 1 Region: 334-410
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6e-16
Family CorC/HlyC domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 188-318
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000525
Family CBS-domain pair 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009871603.1.14984
Sequence length 414
Comment hypothetical protein [Chlamydia trachomatis]; AA=GCF_000173475.1; RF=na; TAX=564416; STAX=813; NAME=Chlamydia trachomatis 6276; AL=Chromosome; RT=Major
Sequence
MFSSAIVILTAIFVLCSGFVSLSHIALFSLPSSLIAHYSHSKNRQLRQIANLMAYPNHLL
MTLVFFDIGINIGVQNCIATLVGDSASLLLTVGVPLALTLVLGEIVPKVIAIPYNARIAK
IVTPIIFASTKSFRPIFDWAISGINFIVQKMLARQESDFIQPQELKEVLRSCKDFGVVNH
EESRLLFGYLSMEEGSIKERMTPKQEIIFYDVLTPIENLYKLFSGPKQSYSKVLVCKGGL
QNLLGVCSAKLLLLYKEKLQSAEELLPLLRKPHYIPETVSAKTALYHLAGEDCGLGIIID
EYGSIEGLITQNDLFKIVSDGVAHNRPSFKQFAHSDKNVVIAAGTYELSDFYDLFGVDLP
TTANCVTIGGWLTEQLGEIPETGTKFAWGQFVFQILDAAPNCVKRVYIRKTHGN
Download sequence
Identical sequences A0A0E9CKP7 A0A0H2X0T2 O84258
gi|527328551|ref|YP_008354741.1| gi|478457904|ref|YP_007731089.1| gi|385242543|ref|YP_005810382.1| 272561.CT256 315277.CTA_0278 580049.JALI_2511 672161.CTB_2511 gi|385243463|ref|YP_005811309.1| gi|237804601|ref|YP_002888755.1| gi|76788978|ref|YP_328064.1| gi|478475025|ref|YP_007724694.1| gi|385239767|ref|YP_005807609.1| gi|15604977|ref|NP_219761.1| gi|478460610|ref|YP_007735561.1| gi|385246153|ref|YP_005814975.1| gi|478455185|ref|YP_007727375.1| gi|385240688|ref|YP_005808529.1| NP_219761.1.57406 WP_009871603.1.100644 WP_009871603.1.101362 WP_009871603.1.102133 WP_009871603.1.13674 WP_009871603.1.14984 WP_009871603.1.17422 WP_009871603.1.20093 WP_009871603.1.34934 WP_009871603.1.38504 WP_009871603.1.4264 WP_009871603.1.43504 WP_009871603.1.5036 WP_009871603.1.52091 WP_009871603.1.55117 WP_009871603.1.60937 WP_009871603.1.61004 WP_009871603.1.61683 WP_009871603.1.62968 WP_009871603.1.65391 WP_009871603.1.67250 WP_009871603.1.71619 WP_009871603.1.72034 WP_009871603.1.72164 WP_009871603.1.72442 WP_009871603.1.74323 WP_009871603.1.75470 WP_009871603.1.77651 WP_009871603.1.83525 WP_009871603.1.86066 WP_009871603.1.87079 WP_009871603.1.92427 WP_009871603.1.93216 WP_009871603.1.9343 WP_009871603.1.97602 gi|478456993|ref|YP_007725586.1| gi|237802679|ref|YP_002887873.1| gi|527319950|ref|YP_008346150.1| gi|527322758|ref|YP_008348955.1| gi|385244343|ref|YP_005812187.1| gi|478459707|ref|YP_007733775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]