SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009871826.1.85365 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009871826.1.85365
Domain Number 1 Region: 142-383
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.2e-66
Family Extended AAA-ATPase domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 5-187
Classification Level Classification E-value
Superfamily CheY-like 1.15e-40
Family CheY-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009871826.1.85365
Sequence length 386
Comment two-component system response regulator [Chlamydia trachomatis]; AA=GCF_000364785.1; RF=na; TAX=1262673; STAX=813; NAME=Chlamydia trachomatis L2/434/Bu(f); strain=L2/434/Bu(f); AL=Complete Genome; RT=Major
Sequence
MSIEHILIIDDDPHILALLSEILGARNFSVSSAPGVKQAIKQISNCPFDLIISDMNMPDG
SGLDIIQYTKQHRPQTPILVITAFGTIQNAVEAMRFGAFNYLTKPFSPDALFTLIAKAEE
LQALQQDNLFLQSQGSSISHPLIAESPSMKQLLDKARRAANSSANIFVHGESGCGKENLS
FFIHKHSPRSTKPYIKVNCAAIPDTLLESEFFGHEKGAFTGATTKKVGRFELAHQGTLLL
DEITEIPIHLQAKLLRAIQEQEFEHIGGIKTLPVNIRFLATSNRDLEEAIETKVLRQDLY
YRLSVISLHIPPLRDRKEDILPLAHYYLEKFCKMNNKPPKTLSLEAQRNLLDYSWPGNVR
ELSNVLERTVILENDPAITPSMLALL
Download sequence
Identical sequences A0A0E9DS79 A0A0H2X131 A0A0H3MHE7 O84474
gi|478453609|ref|YP_007717771.1| gi|385239991|ref|YP_005807833.1| gi|478465331|ref|YP_007742013.1| gi|527318295|ref|YP_008344497.1| gi|478468031|ref|YP_007742904.1| 272561.CT468 315277.CTA_0512 471472.CTL0728 471473.CTLon_0724 gi|527322984|ref|YP_008349181.1| gi|166155557|ref|YP_001653812.1| gi|482546785|ref|YP_007852701.1| gi|76789204|ref|YP_328290.1| gi|527322041|ref|YP_008348239.1| gi|527320175|ref|YP_008346375.1| gi|478463534|ref|YP_007739346.1| gi|478452695|ref|YP_007720443.1| gi|339626147|ref|YP_004717626.1| gi|478447305|ref|YP_007715993.1| gi|385246378|ref|YP_005815200.1| gi|527323945|ref|YP_008350141.1| gi|568111725|ref|YP_008921332.1| gi|527327852|ref|YP_008354043.1| gi|478464431|ref|YP_007741123.1| gi|478475247|ref|YP_007724916.1| gi|482545841|ref|YP_007851759.1| gi|527326003|ref|YP_008352196.1| gi|385244555|ref|YP_005812399.1| gi|478449995|ref|YP_007719552.1| gi|385240915|ref|YP_005808756.1| gi|478462635|ref|YP_007738456.1| gi|478451796|ref|YP_007715102.1| gi|15605195|ref|NP_219981.1| gi|478467130|ref|YP_007718662.1| gi|478458125|ref|YP_007731310.1| gi|385242769|ref|YP_005810608.1| gi|478469840|ref|YP_007723120.1| NP_219981.1.57406 WP_009871826.1.100644 WP_009871826.1.100883 WP_009871826.1.101362 WP_009871826.1.101735 WP_009871826.1.102133 WP_009871826.1.11148 WP_009871826.1.11732 WP_009871826.1.13674 WP_009871826.1.14984 WP_009871826.1.17082 WP_009871826.1.18643 WP_009871826.1.20093 WP_009871826.1.22210 WP_009871826.1.25195 WP_009871826.1.27753 WP_009871826.1.27980 WP_009871826.1.30792 WP_009871826.1.32801 WP_009871826.1.34934 WP_009871826.1.38181 WP_009871826.1.38504 WP_009871826.1.38794 WP_009871826.1.40464 WP_009871826.1.40808 WP_009871826.1.4264 WP_009871826.1.42718 WP_009871826.1.42889 WP_009871826.1.43504 WP_009871826.1.45552 WP_009871826.1.48923 WP_009871826.1.49465 WP_009871826.1.5036 WP_009871826.1.51159 WP_009871826.1.52091 WP_009871826.1.53299 WP_009871826.1.5416 WP_009871826.1.55117 WP_009871826.1.58046 WP_009871826.1.58308 WP_009871826.1.5967 WP_009871826.1.60427 WP_009871826.1.60937 WP_009871826.1.61004 WP_009871826.1.61683 WP_009871826.1.62489 WP_009871826.1.62968 WP_009871826.1.64162 WP_009871826.1.65391 WP_009871826.1.67250 WP_009871826.1.69355 WP_009871826.1.71307 WP_009871826.1.71619 WP_009871826.1.72034 WP_009871826.1.72164 WP_009871826.1.72442 WP_009871826.1.74323 WP_009871826.1.75470 WP_009871826.1.77651 WP_009871826.1.79775 WP_009871826.1.83525 WP_009871826.1.83642 WP_009871826.1.85365 WP_009871826.1.86066 WP_009871826.1.87079 WP_009871826.1.93216 WP_009871826.1.9343 WP_009871826.1.97423 WP_009871826.1.97602 WP_009871826.1.99598 YP_001654800.1.27483 gi|478448197|ref|YP_007722231.1| gi|478460832|ref|YP_007735783.1| gi|478454501|ref|YP_007716880.1| gi|478471630|ref|YP_007740233.1| gi|527328777|ref|YP_008354967.1| gi|478470739|ref|YP_007729380.1| gi|166154682|ref|YP_001654800.1| gi|478459928|ref|YP_007733996.1| gi|478457216|ref|YP_007725809.1| gi|385243675|ref|YP_005811521.1| gi|478450896|ref|YP_007721338.1| gi|478455407|ref|YP_007727597.1| gi|527326925|ref|YP_008353117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]