SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009873849.1.38181 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009873849.1.38181
Domain Number 1 Region: 37-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-32
Family Phosphate binding protein-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009873849.1.38181
Sequence length 261
Comment ABC transporter substrate-binding protein [Chlamydia trachomatis]; AA=GCF_001317705.1; RF=na; TAX=813; STAX=813; NAME=Chlamydia trachomatis; strain=LGV1339; AL=Scaffold; RT=Major
Sequence
MIRGSSLISEVRVKFKYLRPLSFLVLVIVAFCYGCSREKQEVLVGRDATWFPQQFGIYTS
GINAFVNDLVSEINYKEGLNISIVNQDWVHLFENLDDKKTSGAFTSASPSIEMLARYQFS
DPVLLTGPVLVVLENSPYHSLQDLEGKLIGVYKFDSSVLIAQNVPNAVIDSYQHIPVALE
ALSTQRYDALLVPVIEATALVETAYKGRLRIASEPLNEEGLRLVVLRGGGSDSLLEGFNA
GLAKIRRSGRYKAIKMQSRLP
Download sequence
Identical sequences A0A0E9FV45 A0A0H3MHF9
gi|478454521|ref|YP_007716900.1| WP_009873849.1.100883 WP_009873849.1.101735 WP_009873849.1.11148 WP_009873849.1.11732 WP_009873849.1.17082 WP_009873849.1.18643 WP_009873849.1.22210 WP_009873849.1.25195 WP_009873849.1.27753 WP_009873849.1.27980 WP_009873849.1.38181 WP_009873849.1.38794 WP_009873849.1.40464 WP_009873849.1.40808 WP_009873849.1.42718 WP_009873849.1.45552 WP_009873849.1.48923 WP_009873849.1.49465 WP_009873849.1.51159 WP_009873849.1.53299 WP_009873849.1.5416 WP_009873849.1.58046 WP_009873849.1.58308 WP_009873849.1.5967 WP_009873849.1.60427 WP_009873849.1.62489 WP_009873849.1.64162 WP_009873849.1.71307 WP_009873849.1.79775 WP_009873849.1.83642 WP_009873849.1.85365 WP_009873849.1.97423 WP_009873849.1.99598 YP_001654818.1.27483 gi|478453629|ref|YP_007717791.1| gi|478469860|ref|YP_007723140.1| gi|478447325|ref|YP_007716013.1| gi|478471650|ref|YP_007740253.1| gi|482545862|ref|YP_007851780.1| gi|478451816|ref|YP_007715122.1| gi|166155575|ref|YP_001653830.1| gi|478450916|ref|YP_007721358.1| gi|482546806|ref|YP_007852722.1| gi|478468051|ref|YP_007742924.1| gi|478464451|ref|YP_007741143.1| gi|478467150|ref|YP_007718682.1| gi|478450015|ref|YP_007719572.1| gi|527326024|ref|YP_008352217.1| gi|527318316|ref|YP_008344518.1| gi|478462655|ref|YP_007738476.1| 471472.CTL0747 471473.CTLon_0742 gi|527326946|ref|YP_008353138.1| gi|166154700|ref|YP_001654818.1| gi|478463554|ref|YP_007739366.1| gi|478452715|ref|YP_007720463.1| gi|527327873|ref|YP_008354064.1| gi|478465351|ref|YP_007742033.1| gi|527323966|ref|YP_008350162.1| gi|478470759|ref|YP_007729400.1| gi|478448217|ref|YP_007722251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]