SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009966610.1.78686 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009966610.1.78686
Domain Number 1 Region: 150-244
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009966610.1.78686
Sequence length 274
Comment MULTISPECIES: RsbT co-antagonist protein RsbRA [Bacillus]; AA=GCF_000740475.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=NDmed; AL=Contig; RT=Major
Sequence
MMSNQTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSVKDE
NAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFF
SPINTEIFNQYSISWEKTVSLQKIALQELSAPLIPVFENITVMPLVGTIDTERAKRIMEN
LLNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVGAKCLLAGIRPEIAQTIVN
LGIDLSQVITKNTLQKGIQTALEMTDRKIVSLGE
Download sequence
Identical sequences A0A165AYP6 L8ABQ1 P42409
APC1072 224308.BSU04670 gi|428277919|ref|YP_005559654.1| NP_388348.1.22788 WP_009966610.1.100042 WP_009966610.1.11088 WP_009966610.1.11231 WP_009966610.1.11257 WP_009966610.1.1140 WP_009966610.1.11581 WP_009966610.1.12644 WP_009966610.1.12759 WP_009966610.1.14761 WP_009966610.1.15902 WP_009966610.1.16291 WP_009966610.1.18944 WP_009966610.1.19261 WP_009966610.1.20099 WP_009966610.1.20502 WP_009966610.1.21045 WP_009966610.1.2546 WP_009966610.1.27372 WP_009966610.1.27612 WP_009966610.1.27660 WP_009966610.1.2914 WP_009966610.1.31028 WP_009966610.1.31100 WP_009966610.1.31260 WP_009966610.1.31786 WP_009966610.1.32219 WP_009966610.1.32420 WP_009966610.1.32861 WP_009966610.1.33285 WP_009966610.1.33846 WP_009966610.1.34621 WP_009966610.1.36189 WP_009966610.1.37074 WP_009966610.1.3747 WP_009966610.1.39562 WP_009966610.1.40859 WP_009966610.1.42762 WP_009966610.1.43852 WP_009966610.1.44140 WP_009966610.1.44184 WP_009966610.1.45019 WP_009966610.1.47157 WP_009966610.1.51783 WP_009966610.1.5262 WP_009966610.1.52847 WP_009966610.1.52860 WP_009966610.1.54596 WP_009966610.1.54949 WP_009966610.1.55792 WP_009966610.1.56274 WP_009966610.1.56411 WP_009966610.1.57156 WP_009966610.1.57184 WP_009966610.1.57201 WP_009966610.1.5726 WP_009966610.1.57513 WP_009966610.1.6139 WP_009966610.1.63795 WP_009966610.1.6517 WP_009966610.1.65188 WP_009966610.1.65223 WP_009966610.1.65841 WP_009966610.1.67028 WP_009966610.1.71402 WP_009966610.1.7159 WP_009966610.1.72999 WP_009966610.1.74782 WP_009966610.1.76977 WP_009966610.1.78686 WP_009966610.1.78811 WP_009966610.1.79046 WP_009966610.1.79288 WP_009966610.1.79712 WP_009966610.1.79987 WP_009966610.1.80832 WP_009966610.1.81116 WP_009966610.1.81747 WP_009966610.1.82722 WP_009966610.1.84183 WP_009966610.1.84434 WP_009966610.1.84556 WP_009966610.1.87300 WP_009966610.1.88042 WP_009966610.1.88382 WP_009966610.1.88591 WP_009966610.1.89000 WP_009966610.1.91060 WP_009966610.1.91133 WP_009966610.1.93073 WP_009966610.1.93420 WP_009966610.1.94199 WP_009966610.1.95009 WP_009966610.1.96043 WP_009966610.1.97264 WP_009966610.1.979 WP_009966610.1.99091 gi|470160623|ref|YP_007532398.1| gi|402774711|ref|YP_006628655.1| gi|16077534|ref|NP_388348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]