SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009968059.1.39605 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009968059.1.39605
Domain Number 1 Region: 204-338
Classification Level Classification E-value
Superfamily CBS-domain pair 7.2e-33
Family CBS-domain pair 0.0021
Further Details:      
 
Domain Number 2 Region: 349-427
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.54e-16
Family CorC/HlyC domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009968059.1.39605
Sequence length 429
Comment MULTISPECIES: membrane protein [Bacillus]; AA=GCF_001541905.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=CU1050; AL=Complete Genome; RT=Major
Sequence
MLILQLIAIFVLIGITAVFVAAEFAIVKIRGSKINQLIESGDSRALAAHKIISNLDEYLS
ACQLGITITALGLGWLGEPTFERFLHPLFTMTGIPEPFNHIVTFVVAFIIVTFLHVVMGE
LAPKTVSIQKAEAVSLWIAKPLIWFYKITYPFIKALNGSASFLVKLFGFHSVKEHQVVIS
EEELRLILSESYEKGEINQSEFRYVNKIFEFDNRVAREIMIPRTEIAVISLEQSLEEAIH
HIINERYTRYPVIKDDKDHILGIINSKDMFKAYFLGQPIKLNQIMRPVIRVIESIPVQQL
LIRMQKERIHMAILVDEYGGTAGLVTVEDIIEEIVGEIRDEYDQDETPHILKKGEHHYVM
DGKALIDEVNDLLDIAIENEEIDTIAGWLLTQKMELKAGDVIHAEGCEFKILDAEDHHIR
FVEIKKTDF
Download sequence
Identical sequences A0A164TJU7 A0A1D8FLI4 L8AUH2 O05241
gi|560130121|ref|YP_008831262.1| 224308.BSU31300 NP_391008.2.22788 WP_009968059.1.11257 WP_009968059.1.1140 WP_009968059.1.12759 WP_009968059.1.15902 WP_009968059.1.16291 WP_009968059.1.2914 WP_009968059.1.32219 WP_009968059.1.33846 WP_009968059.1.36189 WP_009968059.1.39605 WP_009968059.1.40859 WP_009968059.1.44184 WP_009968059.1.45019 WP_009968059.1.47157 WP_009968059.1.5262 WP_009968059.1.56274 WP_009968059.1.56411 WP_009968059.1.57201 WP_009968059.1.5726 WP_009968059.1.57513 WP_009968059.1.6139 WP_009968059.1.6517 WP_009968059.1.65223 WP_009968059.1.72999 WP_009968059.1.76977 WP_009968059.1.78686 WP_009968059.1.81116 WP_009968059.1.81747 WP_009968059.1.82722 WP_009968059.1.88042 WP_009968059.1.91723 WP_009968059.1.93420 WP_009968059.1.94199 WP_009968059.1.96043 WP_009968059.1.979 gi|255767709|ref|NP_391008.2| gi|402777286|ref|YP_006631230.1| gi|470163343|ref|YP_007535118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]