SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009968930.1.16291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009968930.1.16291
Domain Number 1 Region: 194-592
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.39e-93
Family beta-Lactamase/D-ala carboxypeptidase 0.00000579
Further Details:      
 
Domain Number 2 Region: 59-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.75e-45
Family Penicillin binding protein dimerisation domain 0.000039
Further Details:      
 
Domain Number 3 Region: 601-655
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Domain Number 4 Region: 659-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000576
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009968930.1.16291
Sequence length 716
Comment MULTISPECIES: penicillin-binding protein 2B [Bacillus]; AA=GCF_000293765.1; RF=na; TAX=1220533; STAX=1423; NAME=Bacillus subtilis QB928; strain=QB928; AL=Complete Genome; RT=Major
Sequence
MIQMPKKNKFMNRGAAILSICFALFFFVILGRMAYIQITGKANGEVLATKATEQHEKKRT
IEASRGSILDRKGKVIAEDTATYKLIAILDKKMTTDVKHPQHVVNKEKTAEALSKVINLD
KADILDILNKDAKQVEFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGVFASNLI
GYAEVDEETNEISGAMGLEKVLDKYLKERDGYVTYESDKSGWELPNSKNKITAPKNGDNV
YLTIDQKIQTFLEDSMTKVAQKYNPKKIMAAVVDPKTGKVLAMGQRPSFDPNKRDVTNYY
NDLISYAYEPGSTMKIFTLAAAMQENVFNANEKYKSGTFEVGGAPVKDHNNGVGWGPTTY
HDGVLRSSNVAFAKLAKEKLGYDRLNQYLHKFNFYQKTGIDLPGEVSSKINFKYEFDKAS
TAYGQASAVTPIQQIQAATAIANDGKMMKPYVIDHIVDPDKDKTIYQNKPESAGTPISAS
TAKKVRDILGEVVTSKIGTGQAYKIEGFDVAGKTGTAQIAGKGGYLDGTDNYIFSFMGMA
PKDDPELLIYVAVQQPQLKAGQSSSDPVSEIFNPTMKNSLHYLNIEPTEKSDSDKEETKA
QTMPDLTDQTVAAAQKKAKEENLTPIVIGSDVAVKEQYPKADEEVLTNQKVFLKTGGKIK
MPDMTGWSRREVLQYGELAGIHIEVSGQGYAVSQSVKKDKEIKDKTVIKVKFKNPD
Download sequence
Identical sequences Q07868
gi|255767346|ref|NP_389399.2| gi|402775761|ref|YP_006629705.1| 224308.BSU15160 NP_389399.2.22788 WP_009968930.1.11257 WP_009968930.1.1140 WP_009968930.1.12759 WP_009968930.1.15902 WP_009968930.1.16291 WP_009968930.1.19261 WP_009968930.1.27372 WP_009968930.1.27660 WP_009968930.1.2914 WP_009968930.1.32219 WP_009968930.1.32420 WP_009968930.1.33846 WP_009968930.1.36189 WP_009968930.1.39605 WP_009968930.1.40859 WP_009968930.1.44140 WP_009968930.1.44184 WP_009968930.1.45019 WP_009968930.1.47157 WP_009968930.1.56274 WP_009968930.1.56411 WP_009968930.1.57201 WP_009968930.1.5726 WP_009968930.1.57513 WP_009968930.1.6139 WP_009968930.1.6517 WP_009968930.1.65223 WP_009968930.1.72999 WP_009968930.1.76977 WP_009968930.1.78686 WP_009968930.1.78811 WP_009968930.1.79712 WP_009968930.1.81116 WP_009968930.1.81747 WP_009968930.1.82722 WP_009968930.1.88042 WP_009968930.1.91723 WP_009968930.1.93420 WP_009968930.1.94199 WP_009968930.1.96043 WP_009968930.1.979 gi|470161696|ref|YP_007533471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]