SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009990192.1.43719 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009990192.1.43719
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009990192.1.43719
Sequence length 194
Comment indolepyruvate oxidoreductase [Sulfolobus solfataricus]; AA=GCF_900079115.1; RF=representative genome; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=P1; AL=Complete Genome; RT=Major
Sequence
MAWVNILIAGVGGQGIITAGKIIAEAGNYSNTKVLIAETHGLAQRGGGVNVHVRIGDVNS
PLIPLGKADYLVGLEAIEVLRNLNYASRKHTTIVVNNYVVRPVLPKVKLLTLQEIFDKLK
GCKVYVIDANQIAIKAGNIKAANAAMLGFLYSLGAFEGLINEESFIKALKYESNIKAFKI
AQAIKINGIDINGI
Download sequence
Identical sequences A0A0E3MFE2 D0KPW6 Q97WQ1
gi|15898856|ref|NP_343461.1| gi|384435113|ref|YP_005644471.1| 273057.SSO2069 WP_009990192.1.14611 WP_009990192.1.22626 WP_009990192.1.43719 WP_009990192.1.57434 WP_009990192.1.66040 WP_009990192.1.8449 WP_009990192.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]