SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_009990521.1.66040 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009990521.1.66040
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-51
Family Extended AAA-ATPase domain 0.00036
Further Details:      
 
Domain Number 2 Region: 287-387
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.44e-28
Family Helicase DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009990521.1.66040
Sequence length 397
Comment cell division control protein Cdc6 [Sulfolobus solfataricus]; AA=GCF_000968435.1; RF=na; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=SULA; AL=Complete Genome; RT=Major
Sequence
MSDIIDEVISSFKTSSIFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEKPNNIF
IYGLTGTGKTAVVKFVLSKLHKKFLGKFKHVYINTRQIDTPYRVLADLLESLDVKVPFTG
LSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRINSEVNKSKISFIGI
TNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILTKRAQMAFKPGVLPDNVIKLCAA
LAAREHGDARRALDLLRVSGEIAERMKDTKVKEEYVYMAKEEIERDRVRDIILTLPFHSK
LVLMAVVSISSEENVVSTTGAVYETYLNICKKLGVEAVTQRRVSDIINELDMVGILTAKV
VNRGRYGKTKEIGLAVDKNIIVRSLIESDSRFADLWS
Download sequence
Identical sequences A0A0E3KC68 D0KRV2 Q980N4
WP_009990521.1.14611 WP_009990521.1.22626 WP_009990521.1.43719 WP_009990521.1.57434 WP_009990521.1.66040 WP_009990521.1.8449 WP_009990521.1.93834 gi|384433714|ref|YP_005643072.1| gi|15897201|ref|NP_341806.1| 273057.SSO0257 380652 APC89434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]