SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009993188.1.14611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009993188.1.14611
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-59
Family Extended AAA-ATPase domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 285-355
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.65e-19
Family Helicase DNA-binding domain 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009993188.1.14611
Sequence length 356
Comment ATPase [Sulfolobus solfataricus]; AA=GCF_000024745.1; RF=na; TAX=555311; STAX=2287; NAME=Sulfolobus solfataricus 98/2; strain=98/2; AL=Complete Genome; RT=Major
Sequence
MLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYL
DLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNWNRKDR
LSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMG
LLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGG
IPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSK
CGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Download sequence
Identical sequences A0A0E3GVF9 D0KVC8 Q97Y08
gi|15898368|ref|NP_342973.1| gi|384434785|ref|YP_005644143.1| WP_009993188.1.14611 WP_009993188.1.22626 WP_009993188.1.43719 WP_009993188.1.57434 WP_009993188.1.66040 WP_009993188.1.8449 WP_009993188.1.93834 359645 SsT52 273057.SSO1545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]