SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010075093.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010075093.1.47838
Domain Number 1 Region: 380-470,549-644
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-25
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 2 Region: 200-289
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000206
Family Fibronectin type III 0.00026
Further Details:      
 
Weak hits

Sequence:  WP_010075093.1.47838
Domain Number - Region: 651-688
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000288
Family Type I dockerin domain 0.006
Further Details:      
 
Domain Number - Region: 293-373
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00282
Family Invasin/intimin cell-adhesion fragments 0.014
Further Details:      
 
Domain Number - Region: 471-550
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0165
Family Invasin/intimin cell-adhesion fragments 0.015
Further Details:      
 
Domain Number - Region: 116-194
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0353
Family Invasin/intimin cell-adhesion fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010075093.1.47838
Sequence length 689
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MKIKILSKKVKMFLGLIVLVMLININANAITFNYDIKNKVIEIESDNGLNIKYKYDQDNR
IKEISYGDFKIKYKYDQYGRLSEIRYDDGSRIIYEYDKYGRLIGTRIIPGHVTLVGISVE
KQVYDMDINKTTNIKVIGKYSNGSSRDITNYSTFIVANNNIVTIQNVGIITAKAYGETDL
KISYLDKTCTVKINVINRGTPRKPNAPTGLIAEKVTQNTVNLKWNPAADSLGVAGYDIYS
GSNLVGSTNGTSFSINGLENNKEYTFKVRIKDVNGNLSDFSEEISVKTLNVVTLLDISVE
KEVYDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNENIITVPNQGTIVTKTYGETDL
KISYLDKTYIVKINVTDTTEPSEPEALVAEDITQTTVNLKWAPSTDNAGLAGYDIYLGNN
LVGSTDNISFLVNGLEPDKEYTFKVLAKDVNGNLSDFSEEISVKTLSVVTLLDISVEKEV
YDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNENIIAVPNQGTIVTKNYGETALNIG
YLDKTYTVKIRVVDKIIPSSPNNLVAESITEKTVNLRWSPPIDNVDVVGYDIYLGSDIIG
SADSTSFIVKGLESNKEYIFKVRARDVNGNLSELSEEIKVKTLIDFTLADLSKRYNMSKN
QPEWEEKYDLNNDGIIDIYDIAILCRTLG
Download sequence
Identical sequences D9SQ73
WP_010075093.1.47838 gi|302873271|ref|YP_003841904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]