SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010077365.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010077365.1.47838
Domain Number 1 Region: 119-269
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 5.1e-52
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00011
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 8.34e-32
Family DHN aldolase/epimerase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010077365.1.47838
Sequence length 273
Comment 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MDKIIIKDLEIYANHGVFKEEKTLGQKFILSMELYLDMREAGNTDDLTKSVHYGIVCDQV
DKFFKENTYDLIEKAAEETCKFILTTFKDIKRVKLMLKKPWAPIGKPLDYAAVEIEREWH
RTFISAGSNIGDKMGNIKKAIELLDSRDTIQVEKISKFYNTEPWGYTDQEEFLNCAFEIK
TLLYPKELMGLLLTIEKELKRERTIKWGPRTLDLDIIFYDDFISDDEEVILPHPRMHQRQ
FVLKPLSDIAPYYVHPILKEYIIDLSSKLPELK
Download sequence
Identical sequences D9SKC7
gi|302874554|ref|YP_003843187.1| WP_010077365.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]