SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010190967.1.1812 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010190967.1.1812
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily Formyltransferase 3.79e-30
Family Formyltransferase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010190967.1.1812
Sequence length 209
Comment hypothetical protein [Corynebacterium aurimucosum]; AA=GCF_000022905.1; RF=representative genome; TAX=548476; STAX=169292; NAME=Corynebacterium aurimucosum ATCC 700975; AL=Complete Genome; RT=Major
Sequence
MAKIYLAGSGAFGAACAQALTNAGHTLLGIAAPEEGRGGRGEALTNWAMSRHLPRTSNAL
LRADDIPDGTDLILTAHSHAFVGRKTRARAPYALGYHPSLLPLHRGRAAVEWTARMNERV
TGGTIYHLTDNVDGGPIAAQRHVILPPHLTASEIWREYLFPLGVEMVVDTADAVDAGNVP
YQPQDERKATWEPSLDSKPLYRPELLELP
Download sequence
Identical sequences C3PID1
169292.cauri_1992 WP_010190967.1.1812 WP_010190967.1.84091 gi|227833816|ref|YP_002835523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]