SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010230430.1.85209 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010230430.1.85209
Domain Number - Region: 747-780
Classification Level Classification E-value
Superfamily MIR domain 0.00068
Family MIR domain 0.01
Further Details:      
 
Domain Number - Region: 472-562
Classification Level Classification E-value
Superfamily Release factor 0.0392
Family Release factor 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010230430.1.85209
Sequence length 809
Comment MAC/perforin family protein [Chlamydia muridarum]; AA=GCF_000772145.1; RF=na; TAX=83560; STAX=83560; NAME=Chlamydia muridarum; strain=Nigg3; AL=Complete Genome; RT=Major
Sequence
MPHSPFLYVVQPHSVFNPRLGERHPITLDFIKEKNRLADFIENLPLEIFGAPSFLENASL
EASYVLSRESTKDGTLFTVLEPKLSACVATCLVDSSIPMEPDNELLEEIKHTLLKSSCDG
VQYRVTRETLQNKDEAPRVSLVADDIELIRNVDFLGRSVDIVKLDPLNIPNTVSEENALD
YSFTRETAKLSPDGRVGIPQGTKILPAPSLEVEISTSIFEETSSFEQNFSSSITFCVPPL
TSFSPLQEPPLVGAGQQEILVTKKHLFPSYTPKLIDIVKRHKRDAKILVNKIQFEKLWRS
HAKSQILKEGSVRLDLQGFTGELFNYQLQVGSHTIAAVLIDPEIANVKSLPEQTYAVRKI
KSGFQCSLDDQHIYQVAVKKHLSLSSQPPKISPLSQSESSDLSLFEAAAFSASLTYEFVK
KNTYHAKNTVTCSTVSHSLYILKEDDGANAAEKRLDNSFRNWVENKLNANSPDSCTAFIQ
KFGTHYITSATFGGSGFQVLKLSFEQVEGLRSKKISLEAAAANSLLKSSVSNSTESGYST
YDSSSSSHTVFLGGTVLPSVHDGQLDFKDWSESVCLEPVPIHISLLPLTDLLTPLYFPET
DTTELSNKRNALQQAVRVYLKDHRSAKQSERSVFTAGINSPSSWFTLESANSPLVVSSPY
MTYWSTLPYLFPTLKERSSAAPIVFYFCVDNNEHASQKILNQTYCFIGSLPIRQKIFGRE
FAENPYLSFYGRFGEAYFDGGYPERCGWIVEKLNTTKDQILRDEDEVQLKHVYSGEYLST
IPIKDSHCTLSRTCTESNAVFIIKKPSSY
Download sequence
Identical sequences A0A069ZXE3 Q9PKN4
WP_010230430.1.18971 WP_010230430.1.19393 WP_010230430.1.21797 WP_010230430.1.40339 WP_010230430.1.40903 WP_010230430.1.45721 WP_010230430.1.46238 WP_010230430.1.60880 WP_010230430.1.63773 WP_010230430.1.69188 WP_010230430.1.77803 WP_010230430.1.85209 WP_010230430.1.89087 WP_010230430.1.91588 243161.TC0431 gi|15835049|ref|NP_296808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]