SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010231469.1.60880 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010231469.1.60880
Domain Number 1 Region: 203-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.25e-55
Family B3/B4 domain of PheRS, PheT 0.0000364
Further Details:      
 
Domain Number 2 Region: 479-680
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.12e-38
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00048
Further Details:      
 
Domain Number 3 Region: 41-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-31
Family Myf domain 0.0026
Further Details:      
 
Domain Number 4 Region: 689-782
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.76e-22
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 
Domain Number 5 Region: 407-471
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010231469.1.60880
Sequence length 790
Comment phenylalanine--tRNA ligase subunit beta [Chlamydia muridarum]; AA=GCF_000700885.1; RF=na; TAX=83560; STAX=83560; NAME=Chlamydia muridarum; strain=Var003; AL=Contig; RT=Major
Sequence
MLTPIPLLQRFFSSPLSIKEILQACDRIGIEAECSNVFPDSLNTVVTGKVLSTSPHPDAE
RLSVAIVFDGKEERQIICGAPNCRAGIIVPVALPGAKIRNALGEVTTIKKSKIRGLESLG
MCCGADELGFPHLQTGERGIFEFPENTPLGESACLLLAGASLECSLTPNLGHCASLLGLA
REISFLSDTSLTIPEEFSFSPLPQESHSCDTHNLEASPVFYSVKISGLSWKQSPEDLQAS
LIALGQKPLNAIVDITNYVMLSLGQPLHAYDSQAVDQKSLHATTVRSPQQLTLLNKETYT
LPEGALVVADQHNILGLAGVMGSAASAYSESTTEIILEAAYFLPQAVRKYQRTIQLHTEA
AYRFTRGIDPQGVLPALYAAIHMIRALFPEAQISPIQKIGEYKSDPLSLNIRPKTLKRLL
DLSLSPSEIAEKLSPLGFQTIAEESSVRVEVPLYRHDIQEETDLVEEICRTTPFVQKTQK
ILPTYTPIYALKRSLSTFLADSGLQQFFTCSLLDSEIAALSLQESSLIPVQNSSLKLRDS
LLSGMLKSAATNLNRQAPYVYAFEIGNVYSKEHNQYREEEHIAILLTRQVMDDSWHVKTP
LSFYTIKSWVEKLLCHAGVSIEDFVLQASQHPNFHPYRQAALYHKKQLLGVFGTLHPQLC
KKSQIKHDVVFAELSLNVLLSLKKKTEPHYVPYPIYPSSSRDITITIDKDLPADLVRREL
LSFESKWLESVHIVSVYQGKDVTSQSKNISLRLVFRDHERTLSGQEIEKEYERLTTLLDK
NLANIGKGNS
Download sequence
Identical sequences A0A069ZVV6 Q9PJR8
gi|15835374|ref|NP_297133.1| 243161.TC0760 WP_010231469.1.18971 WP_010231469.1.19393 WP_010231469.1.21797 WP_010231469.1.40339 WP_010231469.1.40903 WP_010231469.1.45721 WP_010231469.1.46238 WP_010231469.1.60880 WP_010231469.1.63773 WP_010231469.1.69188 WP_010231469.1.77803 WP_010231469.1.85209 WP_010231469.1.89087 WP_010231469.1.91588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]