SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010231599.1.60880 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010231599.1.60880
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.57e-33
Family Ribosomal protein L6 0.0000589
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.33e-18
Family Ribosomal protein L6 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010231599.1.60880
Sequence length 183
Comment 50S ribosomal protein L6 [Chlamydia muridarum]; AA=GCF_000700885.1; RF=na; TAX=83560; STAX=83560; NAME=Chlamydia muridarum; strain=Var003; AL=Contig; RT=Major
Sequence
MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVSPAAHIID
RPGRMQGLYWALIANMVKGVHLGFEKRLEMIGVGFRASVQGSFLDLSIGVSHPTKMPIPT
GLEVSVEKNTLISIKGINKQLVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKT
GKK
Download sequence
Identical sequences A0A069ZY42 Q9PJM8
243161.TC0801 WP_010231599.1.18971 WP_010231599.1.19393 WP_010231599.1.21797 WP_010231599.1.40339 WP_010231599.1.40903 WP_010231599.1.45721 WP_010231599.1.46238 WP_010231599.1.60880 WP_010231599.1.63773 WP_010231599.1.69188 WP_010231599.1.77803 WP_010231599.1.85209 WP_010231599.1.89087 WP_010231599.1.91588 gi|15835415|ref|NP_297174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]