SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010258204.1.3534 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010258204.1.3534
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.49e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010258204.1.3534
Sequence length 115
Comment MULTISPECIES: PTS chitobiose transporter subunit IIA [Borreliella]; AA=GCF_000501295.1; RF=na; TAX=1408859; STAX=139; NAME=Borrelia burgdorferi IPT2; strain=IPT2; AL=Contig; RT=Major
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELTIQESKKSIAKAH
EAHREIIHQSATNPNSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences A0A0H3C2F7 C0RQ27 H7C637 O50981
gi|11497018|ref|NP_046991.1|NC_001903 gi|218203986|ref|YP_002364834.1|NC_011724 gi|221317053|ref|YP_002533410.1|NC_011974 gi|224591461|ref|YP_002640766.1|NC_012151 gi|224593662|ref|YP_002640955.1|NC_012157 gi|225576186|ref|YP_002725180.1|NC_012261 gi|225576247|ref|YP_002725233.1|NC_012263 gi|225576388|ref|YP_002725387.1|NC_012267 gi|226246781|ref|YP_002776094.1|NC_012512 gi|226246809|ref|YP_002776120.1|NC_012513 gi|387827989|ref|YP_005805059.1|NC_017401 gi|11497018|ref|NP_046991.1| gi|387827989|ref|YP_005805059.1| NP_046991.1.46978 WP_010258204.1.100172 WP_010258204.1.100372 WP_010258204.1.1709 WP_010258204.1.18535 WP_010258204.1.20994 WP_010258204.1.22230 WP_010258204.1.23946 WP_010258204.1.30682 WP_010258204.1.31711 WP_010258204.1.3534 WP_010258204.1.35366 WP_010258204.1.38241 WP_010258204.1.41722 WP_010258204.1.44797 WP_010258204.1.53248 WP_010258204.1.54040 WP_010258204.1.58911 WP_010258204.1.75039 WP_010258204.1.7957 WP_010258204.1.91101 WP_010258204.1.95407 WP_010258204.1.96757 224326.BBB05 445985.BbuZS7_B05 gi|218203986|ref|YP_002364834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]