SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010264979.1.68643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010264979.1.68643
Domain Number 1 Region: 206-290
Classification Level Classification E-value
Superfamily PKD domain 1.11e-23
Family PKD domain 0.0012
Further Details:      
 
Domain Number 2 Region: 290-637
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.43e-21
Family Quinoprotein alcohol dehydrogenase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 119-203
Classification Level Classification E-value
Superfamily PKD domain 5.89e-18
Family PKD domain 0.0019
Further Details:      
 
Domain Number 4 Region: 28-104
Classification Level Classification E-value
Superfamily PKD domain 3.4e-17
Family PKD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010264979.1.68643
Sequence length 668
Comment cell surface protein [Alistipes timonensis]; AA=GCF_000285455.1; RF=na; TAX=1033731; STAX=1465754; NAME=Alistipes timonensis JC136; strain=P148; AL=Contig; RT=Major
Sequence
MKKLFAIGTCCLLCGLFGCEDSGEADRPAPVAAFTTEKESYAAGEKIGFINTSSFDAGEI
IAYEWDFGDESARSTKKEPVKVYNEAGSYTVRLTVTGSNGAVDQSENSLVIREDDRELVA
DFTFEKEEYAVGEPVAFVNRSSFENGEIVGYAWNFGSGDADDASTEENPSKRYSAPGDYT
VQLTVTTDNGREKSCQKTVTVYDAGTPPVAAFSVAPGIVLAGDEVTFTDLSTDEDGEVVA
WAWEFGDGATSSERHPLHTYPEKGAYKVTLTVTDDAGVTDRQEQTVNVWPGVVWSQEIEA
SSTLRGVIPTVGLDGTIYVTSDKLKLYAYDKSGSRRWVYDLSQDGAGGQQKSSACVGTDG
TVYILAGGSDKTKNIYLYAIRPDGTRKWRYAYPLGAVTGYTSPAIHISGNVLIGNQGTGG
SVILVDKDSGQEMWRTLTVGGGLTGMIASDKAGTAYFGLSGGKGYGAVDAGGVLKSFNVA
DTYDVNGTSIAIDAEGNTYAGVQKSGAGAVVSCDAAGNRRWVFTPDPAGKIDFSGPVLGA
DGTVYISVNKTGGQIAALDGQTGRQLWQYLCADGFGGTPAVDCYGNIHCGDNAGWYHVVK
PDGTLLFKKQLGTNMWSSPVIADDGMIYVNLKDGAACKLIAFDMGLTGPADSPWPQRACT
AAHMALQR
Download sequence
Identical sequences A0A1H4EXJ5
WP_010264979.1.57881 WP_010264979.1.68643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]