SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010319258.1.91986 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010319258.1.91986
Domain Number 1 Region: 4-171
Classification Level Classification E-value
Superfamily MtlR-like 1.31e-56
Family MtlR-like 0.00000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010319258.1.91986
Sequence length 176
Comment MULTISPECIES: MltR family transcriptional regulator [Vibrio]; AA=GCF_002078035.1; RF=na; TAX=55601; STAX=55601; NAME=Vibrio anguillarum; strain=HI618; AL=Contig; RT=Major
Sequence
MADRINESDIIERLNSAHSVRGFFITTVEVFNEAIDALMQRIFRKDNFAVQSVVGPLLQD
SGPLGNLSVRLKLLFGLGVLPDDVYHDIEDIIKLRNQLNSDGAEYEFTDPKILVPIKKLH
LVAKMGMVQLEVLEPDGDIELDFYQLQLQRQQQIIKSGLSLAIVEICNELNKESPF
Download sequence
Identical sequences A0A191W9C9 A0A1E5FQ25 A0A223N1L3 A0A233I191 F7YRM6
WP_010319258.1.102100 WP_010319258.1.14067 WP_010319258.1.1602 WP_010319258.1.1920 WP_010319258.1.20930 WP_010319258.1.21488 WP_010319258.1.22219 WP_010319258.1.23305 WP_010319258.1.23371 WP_010319258.1.2406 WP_010319258.1.27540 WP_010319258.1.29031 WP_010319258.1.29390 WP_010319258.1.29555 WP_010319258.1.29797 WP_010319258.1.34300 WP_010319258.1.35475 WP_010319258.1.41996 WP_010319258.1.46886 WP_010319258.1.52133 WP_010319258.1.55957 WP_010319258.1.6300 WP_010319258.1.63434 WP_010319258.1.70040 WP_010319258.1.77604 WP_010319258.1.82469 WP_010319258.1.84384 WP_010319258.1.85197 WP_010319258.1.91986 WP_010319258.1.99586 gi|336125924|ref|YP_004577880.1| gi|537457077|ref|YP_008489733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]