SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010802079.1.45416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010802079.1.45416
Domain Number 1 Region: 535-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.36e-31
Family alpha-mannosidase, C-terminal domain 0.062
Further Details:      
 
Domain Number 2 Region: 121-319,348-428
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000612
Family alpha-mannosidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010802079.1.45416
Sequence length 964
Comment MULTISPECIES: hypothetical protein [Parabacteroides]; AA=GCF_000403825.2; RF=na; TAX=1235789; STAX=328812; NAME=Parabacteroides goldsteinii dnLKV18; strain=dnLKV18; AL=Scaffold; RT=Major
Sequence
MKKKIAYCLFASVLSSVIYADVVPSSVDYVVRPLYGYRADGTPGRIVTVKLKGKELKGEL
SVDVIAKGKTEKNHFALNAKDSTEVEILLPSTVPTGKKSEVTMVLRGADKVYKQKVSVMP
MRHWNVYLYNHAHVDIGYTNTHKNVEQLHKNNIIEGIKLAEETKNHPEGARYVWNPEIGW
PLERLWQSNPEMRDEVIDAIKKGQVCVDASYLNLNTSICTDEEMFHIFKFTREMQRLSGQ
PADVFQQFDIPGISWGLVPVMAQEGVRYIISWPNSDRAGNAHANMDGKPFWWLGPDGKSK
VLFFQPGSYANSGSMGKGGETGRPWFGQRDPEKVPKVIRTGYANVDFTKQLESMEKDNYP
YDFALFSWSLWDNNPLDADIPFAVKEWNEKYAYPKIRICGGHEIMSMIEDKYGDQLPVVS
GDYTEYWTDGLGTAAGLTAKNRNAKERLTQAETIWSMLADGGKAPRDDFDEAWRYILLGS
EHTWCFENPTEPYFQDAIWKVKQSYFHEAEDRSIDMLDESLAPATDKSNGALGPKEGPSN
GGIAVFNTHSWPQSGVIRLTAKESLKGDKVVDQHGKEVLSQRLSTGELLFYVPEVPALSS
RHFRVVEGKCSLSGSCKIEGTTLENDCLTVHVDQATGNIVSLLKKGSEYNYIGEGANTFS
WLPANVDAPQADTVLSVSVVEEGPLAVELRVVSKATGCRSVSRSVRLLAGQPWVEISNVV
DKLPLVEKDGIHFGFAFNLPDSKTRVDIPWGVMEVEKDQWPQGNRNWLAMQRWLDVSNAT
HGVTWCSLDAPLFEYGNRTANIALGWGDKGNWLKKLEPSSTIYSWVMNNHWHTNFPLTQD
GPVRFRYRLFPHEGYDVVKANRFGLEQSQPLVYATADKVQVVKPVIAIGNDRVYTTILKS
TDKEKELIVRLRSLSDKEESVKLSFPKADPKSLMICDREENPSRSTNGELTMKPYGQVTL
QLKY
Download sequence
Identical sequences S0GRT3
WP_010802079.1.45416 WP_010802079.1.51638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]