SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010865151.1.29620 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010865151.1.29620
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.11e-57
Family PP-loop ATPase 0.0000283
Further Details:      
 
Domain Number 2 Region: 324-387
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010865151.1.29620
Sequence length 414
Comment tRNA(Ile)-lysidine synthetase [Thermotoga maritima]; AA=GCF_000230655.2; RF=na; TAX=243274; STAX=2336; NAME=Thermotoga maritima MSB8; strain=MSB8; AL=Complete Genome; RT=Major
Sequence
MLEEGEHVLVAVSGGIDSMTLLYVLRKFSPLLKIKITAAHLDHRIRESSRRDREFVERIC
RQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLE
TVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYARKNNVPYVVDETNYNVKYT
RNFIRHRIVPLMKELNPTVEDAVYRLVSVTHLLRNFVERTVQDFVERNVYFYKDYAVFVE
PEDLFLFLEVTRWVLKEMYGRVPEYEKLIGTLKSKRVELWSGIFVERSFGYVAVGKTVFK
KKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIVNGRERKLKDVFIEKKVP
TFYRDRVPLLVDEEDRVLWVPGIARSDFLPEDVVVELLEYPVGYVKGGTYFEQV
Download sequence
Identical sequences Q9WZ48 R4NYV0
gi|15643345|ref|NP_228389.1| 243274.TM0579 282452 APC4275 NYSGXRC-T667 NP_228389.1.35502 WP_010865151.1.29620 WP_010865151.1.45724 WP_010865151.1.51363 WP_010865151.1.56403 WP_010865151.1.79805 gi|15643345|ref|NP_228389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]