SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010871834.1.99424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010871834.1.99424
Domain Number 1 Region: 207-451
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.07e-72
Family Extended AAA-ATPase domain 0.0000000367
Further Details:      
 
Domain Number 2 Region: 461-655
Classification Level Classification E-value
Superfamily FtsH protease domain-like 9.29e-69
Family FtsH protease domain-like 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010871834.1.99424
Sequence length 665
Comment ATP-dependent zinc metalloprotease FtsH 1 [Synechocystis sp. PCC 6803]; AA=GCF_000284135.1; RF=na; TAX=1080228; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. GT-I; strain=PCC 6803 substr. GT-I; AL=Complete Genome; RT=Major
Sequence
MSHRPRSDRHSFSSPSRFWHRLGMGLLVAGTLALPVSTLAQEGGEGAQPKASPSPIQSPN
SSNGEATPRSFFNSGSPRSAEPKMNYGQLIDAIKANQVAKVEVDTNRRQAIVTLKDAPPG
SKPQTVQLLDNNPELLNLLRSRSETIDLDINRTPDNSALYGLLTNLLVVAILIGLVVMVV
RRSANASGQAMSFGKSKARFQMEAKTGVGFDDVAGIDEAKEELQEVVTFLKQPEKFTAIG
AKIPRGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAK
ENAPCLVFIDEIDAVGRQRGVGYGGGNDEREQTLNQLLTEMDGFEGNSGIIVIAATNRPD
VLDLALLRPGRFDRQVTVDYPDVQGRELILAIHAQNKKLHEEVQLAAIARRTPGFTGADL
ANVLNEAAIFTARRRKEAITMAEVNDAIDRVVAGMEGTPLVDSKSKRLIAYHEVGHALIG
TLCPGHDPVEKVTLIPRGQAQGLTWFTPDEDQSLMTRNQMIARIAGLLGGRVAEEVIFGD
DEVTTGAGNDIEKITYLARQMVTKLGMSSLGLVALEEEGDRNFSGGDWGKRSEYSEDIAA
RIDREIQAIVTAAHQRATRIIEENRNLMDLLVDALIDQETIEGEHFRQLVESYQQSQKQP
ALAGK
Download sequence
Identical sequences P73179
gi|383321539|ref|YP_005382392.1| gi|16329797|ref|NP_440525.1| WP_010871834.1.11876 WP_010871834.1.1889 WP_010871834.1.18904 WP_010871834.1.33690 WP_010871834.1.35395 WP_010871834.1.47586 WP_010871834.1.99424 gi|383324709|ref|YP_005385562.1| gi|383490593|ref|YP_005408269.1| 1148.slr1390 gi|16329797|ref|NP_440525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]