SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010871965.1.11876 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010871965.1.11876
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.19e-36
Family Ribosomal protein L6 0.0000394
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.11e-24
Family Ribosomal protein L6 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010871965.1.11876
Sequence length 179
Comment 50S ribosomal protein L6 [Synechocystis sp. PCC 6803]; AA=GCF_000284455.1; RF=na; TAX=1080230; STAX=1148; NAME=Synechocystis sp. PCC 6803 substr. PCC-P; strain=PCC 6803 substr. PCC-P; AL=Complete Genome; RT=Major
Sequence
MSRIGKRPIPLPAKVSVDIQGSHLSVKGPKGSLERQLPEKVIVAQEGETITVTRQDESRT
ARERHGLVRTLVANMVDGVAQGFERRLEIQGVGYRAQAQGNKLTLNVGYSKPVEMTMPQG
IEVKVENNTQVIVSGIDKELLGNTAAKIRAVRPPEPYKGKGIRYQGEYVRRKAGKTGKK
Download sequence
Identical sequences L8AGE8 P73306
gi|383324839|ref|YP_005385692.1| WP_010871965.1.11876 WP_010871965.1.1889 WP_010871965.1.18904 WP_010871965.1.33690 WP_010871965.1.35395 WP_010871965.1.47586 WP_010871965.1.99424 1148.sll1810 gi|383321670|ref|YP_005382523.1| gi|16329927|ref|NP_440655.1| gi|16329927|ref|NP_440655.1| gi|383490723|ref|YP_005408399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]