SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010872125.1.35395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010872125.1.35395
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.58e-19
Family Barwin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010872125.1.35395
Sequence length 90
Comment hypothetical protein [Synechocystis sp. PCC 6803]; AA=GCF_000009725.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MMAQSATFYGNQFVGRKMANGQVYNHGRMVAAHPSLPLGTRVRVTNRRTGKSVVVTVSDR
CNCSIDLSRSAFQQIANPRKGRVPVSITRL
Download sequence
Identical sequences P73455
gi|16330087|ref|NP_440815.1| gi|383490883|ref|YP_005408559.1| gi|383324999|ref|YP_005385852.1| WP_010872125.1.11876 WP_010872125.1.1889 WP_010872125.1.18904 WP_010872125.1.33690 WP_010872125.1.35395 WP_010872125.1.47586 WP_010872125.1.99424 1148.ssl3177 gi|16330087|ref|NP_440815.1| gi|383321830|ref|YP_005382683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]